ITGAX (integrin subunit alpha X)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3687
Gene name Gene Name - the full gene name approved by the HGNC.
Integrin subunit alpha X
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ITGAX
Synonyms (NCBI Gene) Gene synonyms aliases
CD11C, SLEB6
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(86)
miRTarBase ID miRNA Experiments Reference
MIRT030204 hsa-miR-26b-5p Microarray 19088304
MIRT1073963 hsa-miR-1262 CLIP-seq
MIRT1073964 hsa-miR-2114 CLIP-seq
MIRT1073965 hsa-miR-25 CLIP-seq
MIRT1073966 hsa-miR-32 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(8)
Transcription factor Regulation Reference
CEBPA Activation 9360988
JUN Unknown 8649405;8649434
NFKB1 Unknown 7678251
RELA Unknown 7678251
SP1 Unknown 7678251;8649405
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(45)
GO ID Ontology Definition Evidence Reference
GO:0005178 Function Integrin binding TAS 8020569
GO:0005515 Function Protein binding IPI 17726152, 20033057, 20679211
GO:0005886 Component Plasma membrane TAS
GO:0007155 Process Cell adhesion IEA
GO:0007155 Process Cell adhesion TAS 2303426
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
151510 6152 ENSG00000140678
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P20702
Protein name Integrin alpha-X (CD11 antigen-like family member C) (Leu M5) (Leukocyte adhesion glycoprotein p150,95 alpha chain) (Leukocyte adhesion receptor p150,95) (CD antigen CD11c)
Protein function Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis.
PDB 1N3Y , 2LUV , 3K6S , 3K71 , 3K72 , 4NEH , 4NEN , 5ES4
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00092 VWA 151 → 328 von Willebrand factor type A domain Domain
PF01839 FG-GAP 458 → 495 FG-GAP repeat Repeat
PF01839 FG-GAP 521 → 556 FG-GAP repeat Repeat
PF08441 Integrin_alpha2 615 → 1015 Integrin alpha Family
PF00357 Integrin_alpha 1129 → 1143 Integrin alpha cytoplasmic region Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in monocytes and granulocytes.
Sequence 
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK
RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGTQTPSPPSEK
Sequence length 1163
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Complement and coagulation cascades
Regulation of actin cytoskeleton
Tuberculosis 		  Cell surface interactions at the vascular wall
Integrin cell surface interactions
ECM proteoglycans
Interleukin-4 and Interleukin-13 signaling
Neutrophil degranulation
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Show/Hide Text Mining Associations (161)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acrodermatitis Associate 17324275
Acute On Chronic Liver Failure Associate 36505417
Adenocarcinoma of Lung Associate 33461176
Allergic Fungal Sinusitis Associate 25361058
Alzheimer Disease Associate 40465637
Arthritis Rheumatoid Associate 12417058, 18727628, 31061532, 32824307, 39346909, 39925810
Arthritis Rheumatoid Stimulate 28376277, 31882654
Ascites Associate 17094388
Asthma Associate 25420684
Atherosclerosis Associate 19800635, 21030716, 23918401, 32824307, 35287505