Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3687
Gene name	Integrin subunit alpha X
Gene symbol	ITGAX
Synonyms (NCBI Gene)	CD11CSLEB6
Chromosome	16
Chromosome location	16p11.2
Summary	This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to

Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030204	hsa-miR-26b-5p	Microarray	19088304
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073964	hsa-miR-2114	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT1073967	hsa-miR-338-3p	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073969	hsa-miR-3664-3p	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT1073972	hsa-miR-4433	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073974	hsa-miR-4768-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073976	hsa-miR-510	CLIP-seq
MIRT1073977	hsa-miR-512-5p	CLIP-seq
MIRT1073978	hsa-miR-542-3p	CLIP-seq
MIRT1073979	hsa-miR-550a	CLIP-seq
MIRT1073980	hsa-miR-661	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT2018286	hsa-miR-3181	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT2018287	hsa-miR-4649-5p	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT2250143	hsa-miR-298	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT2250144	hsa-miR-3944-5p	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073978	hsa-miR-542-3p	CLIP-seq
MIRT1073980	hsa-miR-661	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT2250145	hsa-miR-922	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq
MIRT2018286	hsa-miR-3181	CLIP-seq
MIRT2018287	hsa-miR-4649-5p	CLIP-seq
MIRT2250143	hsa-miR-298	CLIP-seq
MIRT2250144	hsa-miR-3944-5p	CLIP-seq
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT2553697	hsa-miR-3613-3p	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT2553698	hsa-miR-371-5p	CLIP-seq
MIRT2553699	hsa-miR-371b-5p	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073978	hsa-miR-542-3p	CLIP-seq
MIRT1073980	hsa-miR-661	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq
MIRT1073963	hsa-miR-1262	CLIP-seq
MIRT1073965	hsa-miR-25	CLIP-seq
MIRT1073966	hsa-miR-32	CLIP-seq
MIRT2553697	hsa-miR-3613-3p	CLIP-seq
MIRT1073968	hsa-miR-363	CLIP-seq
MIRT1073970	hsa-miR-367	CLIP-seq
MIRT2553698	hsa-miR-371-5p	CLIP-seq
MIRT2553699	hsa-miR-371b-5p	CLIP-seq
MIRT1073971	hsa-miR-4325	CLIP-seq
MIRT1073973	hsa-miR-4701-3p	CLIP-seq
MIRT1073975	hsa-miR-508-5p	CLIP-seq
MIRT1073980	hsa-miR-661	CLIP-seq
MIRT1073981	hsa-miR-766	CLIP-seq
MIRT1073982	hsa-miR-92a	CLIP-seq
MIRT1073983	hsa-miR-92b	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
CEBPA	Activation	9360988
JUN	Unknown	8649405;8649434
NFKB1	Unknown	7678251
RELA	Unknown	7678251
SP1	Unknown	7678251;8649405
SPI1	Repression	9295016
SPI1	Unknown	7678251
WT1	Activation	9484784

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005178	Function	Integrin binding	TAS	8020569
GO:0005515	Function	Protein binding	IPI	17726152, 20033057, 20679211
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	2303426
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	NAS	19693543
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	19693543
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	30873824
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	2303426
GO:0009887	Process	Animal organ morphogenesis	TAS	3327687
GO:0009893	Process	Positive regulation of metabolic process	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	HDA	23981064
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IC	20563599
GO:0009986	Component	Cell surface	IDA	19234460
GO:0009986	Component	Cell surface	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	30873824
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	30873824
GO:0030667	Component	Secretory granule membrane	TAS
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	30873824
GO:0031643	Process	Positive regulation of myelination	IEA
GO:0031643	Process	Positive regulation of myelination	ISS
GO:0034113	Process	Heterotypic cell-cell adhesion	IMP	20563599
GO:0034689	Component	Integrin alphaX-beta2 complex	IBA
GO:0034689	Component	Integrin alphaX-beta2 complex	IPI	20033057
GO:0034689	Component	Integrin alphaX-beta2 complex	TAS	8020569
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	TAS	2303426
GO:0045766	Process	Positive regulation of angiogenesis	IMP	30873824
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0070821	Component	Tertiary granule membrane	IEA
GO:0070821	Component	Tertiary granule membrane	TAS
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1905956	Process	Positive regulation of endothelial tube morphogenesis	IMP	30873824

MIM	HGNC	e!Ensembl
151510	6152	ENSG00000140678

P20702

Protein name

Integrin alpha-X (CD11 antigen-like family member C) (Leu M5) (Leukocyte adhesion glycoprotein p150,95 alpha chain) (Leukocyte adhesion receptor p150,95) (CD antigen CD11c)

Protein function

Integrin alpha-X/beta-2 is a receptor for fibrinogen. It recognizes the sequence G-P-R in fibrinogen. It mediates cell-cell interaction during inflammatory responses. It is especially important in monocyte adhesion and chemotaxis.

PDB

1N3Y , 2LUV , 3K6S , 3K71 , 3K72 , 4NEH , 4NEN , 5ES4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00092	VWA	151 → 328	von Willebrand factor type A domain	Domain
PF01839	FG-GAP	458 → 495	FG-GAP repeat	Repeat
PF01839	FG-GAP	521 → 556	FG-GAP repeat	Repeat
PF08441	Integrin_alpha2	615 → 1015	Integrin alpha	Family
PF00357	Integrin_alpha	1129 → 1143	Integrin alpha cytoplasmic region	Family

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in monocytes and granulocytes.

Sequence

MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK
RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGTQTPSPPSEK

Sequence length

1163

Interactions

View interactions

	KEGG		Reactome
	Complement and coagulation cascades Regulation of actin cytoskeleton Tuberculosis		Cell surface interactions at the vascular wall Integrin cell surface interactions ECM proteoglycans Interleukin-4 and Interleukin-13 signaling Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (161)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Acrodermatitis	Associate	17324275	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute On Chronic Liver Failure	Associate	36505417	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of Lung	Associate	33461176	★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic Fungal Sinusitis	Associate	25361058	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Associate	40465637	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Rheumatoid	Associate	12417058, 18727628, 31061532, 32824307, 39346909, 39925810	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Stimulate	28376277, 31882654	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ascites	Associate	17094388	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Associate	25420684	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Associate	19800635, 21030716, 23918401, 32824307, 35287505	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Associate	32389013	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Stimulate	32158442	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Associate	33815388, 34424567, 38350043	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Associate	27108704	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Associate	2049307	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Associate	26849056	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Associate	36380012	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	36946266, 40419887	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	36798119	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	31556561	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Associate	27986748	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Stimulate	38031731	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	19387481	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Associate	36035865	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Associate	34140767, 36316672	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chilblains	Associate	32779733	★★★★★ ★☆☆☆☆ Found in Text Mining only
Classical Lissencephalies and Subcortical Band Heterotopias	Associate	32922405	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Associate	17602351, 27001939, 35068859	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Stimulate	19737136	★★★★★ ★☆☆☆☆ Found in Text Mining only
Communicable Diseases	Associate	36798119	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart block	Associate	30518570	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Stimulate	20628522	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Associate	27727089	★★★★★ ★☆☆☆☆ Found in Text Mining only
COVID 19	Associate	32779733, 36052061	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coxa Magna	Associate	36123924	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Associate	17602351, 32076066	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryoglobulinemia Familial Mixed	Associate	21421840	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Associate	35299244	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Plaque	Associate	23273713	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Stimulate	32954523	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Associate	32954523, 33675790	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Associate	37873933	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Stimulate	30894181, 34990410	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Inhibit	15584977	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Inhibit	27095356	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Associate	35281591	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Associate	25038256	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysbiosis	Associate	37099426	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Associate	28358435	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Stimulate	39387602	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Associate	21921589	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epstein Barr Virus Infections	Stimulate	36248899	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Associate	35934868	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Associate	37033160	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis	Associate	35934868	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Associate	26309367	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Associate	37600779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Associate	35316217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Associate	26028593, 30042224, 37685869	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Associate	32453711	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granuloma	Associate	22727562, 39373788	★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Disease Chronic	Associate	14688376	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Associate	35386700, 8025214	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Associate	9158103	★★★★★ ★☆☆☆☆ Found in Text Mining only
HAIR AN syndrome	Stimulate	22904171	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Associate	16252253	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Stimulate	31279905	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytic Sarcoma	Associate	1647137	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytosis	Associate	33950285	★★★★★ ★☆☆☆☆ Found in Text Mining only
HIV Infections	Associate	11588058, 30735686, 34721433, 35432380	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Associate	35586138	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Associate	28091516	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Stimulate	21030716	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	26005050	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Inhibit	36093941	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infections	Associate	17166903, 7545080	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Associate	19737136, 20357360, 21030716, 22904171, 23118428, 23918401, 28508444, 29617296, 30294859, 32922405, 33946738, 35068859, 36123924, 36603481, 39523420	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammation	Inhibit	32076066, 35386700	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Associate	17602351, 19737136, 28797042, 29743615	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Stimulate	27001939	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Associate	20357360	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Associate	33729517	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Associate	32265898, 32938960	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Associate	11937543, 15055269, 1701669, 17891925, 2783862, 33301193	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia B Cell	Associate	1694698	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Associate	10414592, 10419901, 10601997, 11079033, 12576324, 1694698, 1701669, 23347903, 24903677, 29110361, 34561502, 34710243, 37530550, 38440808, 7688993, 8602628 View all (1 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Associate	12447961, 15055269, 1586717, 1694698, 1701669, 18426971, 2049307, 35871396, 7688993, 8167342, 8286829, 8602628, 9885225	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphocytic Chronic B Cell	Stimulate	17053842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	11823047, 35924822	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Prolymphocytic	Associate	1694698, 8167342	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Associate	25239423, 33301193	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Associate	35281597	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lichen Planus	Associate	18055547	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lichen Planus Oral	Associate	28278185	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Associate	17036394	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Associate	22727562, 26388238	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Stimulate	10607488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Inhibit	11315925	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Associate	16178860, 18204098, 19129174, 29058308, 31090539, 31536480, 33777025, 34569195, 37638026, 37675114	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Associate	11937543, 26968188, 34166375	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Associate	1381563	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell	Stimulate	17053842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma B Cell Marginal Zone	Associate	18500740, 29220870	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Associate	18500740	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Large B Cell Diffuse	Associate	26968188, 35715938	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Mantle Cell	Stimulate	17053842	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Non Hodgkin	Associate	12406901	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Associate	1701669, 2049307	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Associate	12542483	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Associate	34691054	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningeal Neoplasms	Associate	34691054	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Associate	31183389	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Associate	34290221, 36536067	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Associate	11966770, 34424567	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Inhibit	23714180	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Associate	23918401	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Stimulate	32389013	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Associate	30894181	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myositis	Associate	35371068	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Stimulate	25361058	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Associate	25469646	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	1347707, 15889251, 24120241, 26759006, 31556561, 32052078, 32814992, 33106165, 34561502, 34864309, 35715938, 35793874, 36798119, 36946266, 37196647, 40069763 View all (1 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Associate	1762294	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Associate	20357360, 27698011, 32188105, 32928872, 33033337	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Stimulate	29617296	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteolysis	Associate	27196532	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Associate	26823856	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Associate	33052561	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pain	Stimulate	37445910	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraproteinemias	Associate	18245015	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Inhibit	32158442	★★★★★ ★☆☆☆☆ Found in Text Mining only
Plaque Atherosclerotic	Associate	34140767	★★★★★ ★☆☆☆☆ Found in Text Mining only
Plaque Atherosclerotic	Stimulate	35396143	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural Effusion	Associate	32052078	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Associate	22904171	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Stimulate	23118428	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymyalgia Rheumatica	Associate	37600779	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyps	Associate	26309367	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	11703324, 14871251	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Associate	16645593	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Stimulate	16907910	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Associate	25420684	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Embolism	Stimulate	23726092	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulpitis	Associate	39346909	★★★★★ ★☆☆☆☆ Found in Text Mining only
Purpura Thrombocytopenic Idiopathic	Associate	31651870	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Artery Obstruction	Associate	38031731	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoschisis	Inhibit	33601057	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Associate	40081680	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Associate	39273179	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Associate	32201227	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Asthmaticus	Associate	25361058	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Associate	34864309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	26309367, 34864309	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tertiary Lymphoid Structures	Associate	32814992	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboangiitis Obliterans	Associate	20529829	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tremor	Associate	34320404	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Associate	30348717	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberculosis	Associate	7518366	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Associate	29435587	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Stimulate	28091516	★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Associate	15678279	★★★★★ ★☆☆☆☆ Found in Text Mining only

ITGAX (integrin subunit alpha X)