Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3683
Gene name	Integrin subunit alpha L
Gene symbol	ITGAL
Synonyms (NCBI Gene)	CD11ALFA-1LFA1A
Chromosome	16
Chromosome location	16p11.2
Summary	ITGAL encodes the integrin alpha L chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form the integrin lymphocyte fu

188

Show/Hide all (188)

miRTarBase ID	miRNA	Experiments	Reference
MIRT631592	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT631591	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631590	hsa-miR-764	HITS-CLIP	23824327
MIRT631589	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631588	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT631587	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT631586	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT631585	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631584	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT631583	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT631582	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT631581	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631580	hsa-miR-640	HITS-CLIP	23824327
MIRT631579	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT631592	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT631591	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631590	hsa-miR-764	HITS-CLIP	23824327
MIRT631589	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631588	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT631587	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT631586	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT631585	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631584	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT631583	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT631582	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT631581	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631580	hsa-miR-640	HITS-CLIP	23824327
MIRT631579	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT631592	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT631591	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631590	hsa-miR-764	HITS-CLIP	23824327
MIRT631589	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631588	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT631587	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT631586	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT631585	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631584	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT631583	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT631582	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT631581	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631580	hsa-miR-640	HITS-CLIP	23824327
MIRT631579	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT631592	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT631591	hsa-miR-125a-3p	HITS-CLIP	23824327
MIRT631590	hsa-miR-764	HITS-CLIP	23824327
MIRT631589	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT631588	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT631587	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT631586	hsa-miR-3189-3p	HITS-CLIP	23824327
MIRT631585	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT631584	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT631583	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT631582	hsa-miR-4764-3p	HITS-CLIP	23824327
MIRT631581	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT631580	hsa-miR-640	HITS-CLIP	23824327
MIRT631579	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT1073773	hsa-miR-1227	CLIP-seq
MIRT1073774	hsa-miR-1252	CLIP-seq
MIRT1073775	hsa-miR-1254	CLIP-seq
MIRT1073776	hsa-miR-1290	CLIP-seq
MIRT1073777	hsa-miR-1304	CLIP-seq
MIRT1073778	hsa-miR-130a	CLIP-seq
MIRT1073779	hsa-miR-130b	CLIP-seq
MIRT1073780	hsa-miR-139-3p	CLIP-seq
MIRT1073781	hsa-miR-218	CLIP-seq
MIRT1073782	hsa-miR-301a	CLIP-seq
MIRT1073783	hsa-miR-301b	CLIP-seq
MIRT1073784	hsa-miR-3116	CLIP-seq
MIRT1073785	hsa-miR-3126-5p	CLIP-seq
MIRT1073786	hsa-miR-3149	CLIP-seq
MIRT1073787	hsa-miR-3167	CLIP-seq
MIRT1073788	hsa-miR-3650	CLIP-seq
MIRT1073789	hsa-miR-3666	CLIP-seq
MIRT1073790	hsa-miR-3672	CLIP-seq
MIRT1073791	hsa-miR-4294	CLIP-seq
MIRT1073792	hsa-miR-4295	CLIP-seq
MIRT1073793	hsa-miR-4419a	CLIP-seq
MIRT1073794	hsa-miR-4423-5p	CLIP-seq
MIRT1073795	hsa-miR-4428	CLIP-seq
MIRT1073796	hsa-miR-4438	CLIP-seq
MIRT1073797	hsa-miR-4476	CLIP-seq
MIRT1073798	hsa-miR-4496	CLIP-seq
MIRT1073799	hsa-miR-4510	CLIP-seq
MIRT1073800	hsa-miR-4514	CLIP-seq
MIRT1073801	hsa-miR-4533	CLIP-seq
MIRT1073802	hsa-miR-454	CLIP-seq
MIRT1073803	hsa-miR-4671-3p	CLIP-seq
MIRT1073804	hsa-miR-4690-3p	CLIP-seq
MIRT1073805	hsa-miR-4692	CLIP-seq
MIRT1073806	hsa-miR-4715-3p	CLIP-seq
MIRT1073807	hsa-miR-5095	CLIP-seq
MIRT1073808	hsa-miR-518a-5p	CLIP-seq
MIRT1073809	hsa-miR-527	CLIP-seq
MIRT1073810	hsa-miR-636	CLIP-seq
MIRT1073811	hsa-miR-720	CLIP-seq
MIRT1073812	hsa-miR-876-5p	CLIP-seq
MIRT1073813	hsa-miR-940	CLIP-seq
MIRT1073814	hsa-miR-4733-5p	CLIP-seq
MIRT1073815	hsa-miR-4761-5p	CLIP-seq
MIRT2018210	hsa-miR-4279	CLIP-seq
MIRT2018211	hsa-miR-106a	CLIP-seq
MIRT2018212	hsa-miR-106b	CLIP-seq
MIRT2018213	hsa-miR-17	CLIP-seq
MIRT2018214	hsa-miR-20a	CLIP-seq
MIRT2018215	hsa-miR-20b	CLIP-seq
MIRT2018216	hsa-miR-302a	CLIP-seq
MIRT2018217	hsa-miR-302b	CLIP-seq
MIRT2018218	hsa-miR-302c	CLIP-seq
MIRT2018219	hsa-miR-302d	CLIP-seq
MIRT2018220	hsa-miR-302e	CLIP-seq
MIRT2018221	hsa-miR-372	CLIP-seq
MIRT2018222	hsa-miR-373	CLIP-seq
MIRT2018223	hsa-miR-512-3p	CLIP-seq
MIRT2018224	hsa-miR-519d	CLIP-seq
MIRT2018225	hsa-miR-520a-3p	CLIP-seq
MIRT2018226	hsa-miR-520b	CLIP-seq
MIRT2018227	hsa-miR-520c-3p	CLIP-seq
MIRT2018228	hsa-miR-520d-3p	CLIP-seq
MIRT2018229	hsa-miR-520e	CLIP-seq
MIRT2018230	hsa-miR-520g	CLIP-seq
MIRT2018231	hsa-miR-520h	CLIP-seq
MIRT2018232	hsa-miR-93	CLIP-seq
MIRT2250096	hsa-miR-1236	CLIP-seq
MIRT1073774	hsa-miR-1252	CLIP-seq
MIRT2250097	hsa-miR-1324	CLIP-seq
MIRT2250098	hsa-miR-1827	CLIP-seq
MIRT2250099	hsa-miR-1915	CLIP-seq
MIRT2250100	hsa-miR-24	CLIP-seq
MIRT2250101	hsa-miR-2467-3p	CLIP-seq
MIRT2250102	hsa-miR-3677-5p	CLIP-seq
MIRT2250103	hsa-miR-4284	CLIP-seq
MIRT1073797	hsa-miR-4476	CLIP-seq
MIRT1073798	hsa-miR-4496	CLIP-seq
MIRT1073801	hsa-miR-4533	CLIP-seq
MIRT2250104	hsa-miR-4726-3p	CLIP-seq
MIRT2250105	hsa-miR-4753-3p	CLIP-seq
MIRT2250106	hsa-miR-4772-3p	CLIP-seq
MIRT2250107	hsa-miR-759	CLIP-seq
MIRT1073778	hsa-miR-130a	CLIP-seq
MIRT1073779	hsa-miR-130b	CLIP-seq
MIRT1073782	hsa-miR-301a	CLIP-seq
MIRT1073783	hsa-miR-301b	CLIP-seq
MIRT1073789	hsa-miR-3666	CLIP-seq
MIRT1073792	hsa-miR-4295	CLIP-seq
MIRT1073802	hsa-miR-454	CLIP-seq
MIRT2389517	hsa-miR-652	CLIP-seq
MIRT2451998	hsa-miR-122	CLIP-seq
MIRT1073780	hsa-miR-139-3p	CLIP-seq
MIRT2451999	hsa-miR-3135b	CLIP-seq
MIRT2452000	hsa-miR-3652	CLIP-seq
MIRT2452001	hsa-miR-4276	CLIP-seq
MIRT1073791	hsa-miR-4294	CLIP-seq
MIRT1073794	hsa-miR-4423-5p	CLIP-seq
MIRT2452002	hsa-miR-4430	CLIP-seq
MIRT1073811	hsa-miR-720	CLIP-seq
MIRT2452001	hsa-miR-4276	CLIP-seq
MIRT2451998	hsa-miR-122	CLIP-seq
MIRT1073778	hsa-miR-130a	CLIP-seq
MIRT1073779	hsa-miR-130b	CLIP-seq
MIRT2250100	hsa-miR-24	CLIP-seq
MIRT1073782	hsa-miR-301a	CLIP-seq
MIRT1073783	hsa-miR-301b	CLIP-seq
MIRT2451999	hsa-miR-3135b	CLIP-seq
MIRT2452000	hsa-miR-3652	CLIP-seq
MIRT1073789	hsa-miR-3666	CLIP-seq
MIRT2250103	hsa-miR-4284	CLIP-seq
MIRT1073792	hsa-miR-4295	CLIP-seq
MIRT1073794	hsa-miR-4423-5p	CLIP-seq
MIRT2452002	hsa-miR-4430	CLIP-seq
MIRT1073802	hsa-miR-454	CLIP-seq
MIRT2250106	hsa-miR-4772-3p	CLIP-seq
MIRT2389517	hsa-miR-652	CLIP-seq
MIRT2451998	hsa-miR-122	CLIP-seq
MIRT1073778	hsa-miR-130a	CLIP-seq
MIRT1073779	hsa-miR-130b	CLIP-seq
MIRT2250100	hsa-miR-24	CLIP-seq
MIRT1073782	hsa-miR-301a	CLIP-seq
MIRT1073783	hsa-miR-301b	CLIP-seq
MIRT2451999	hsa-miR-3135b	CLIP-seq
MIRT2452000	hsa-miR-3652	CLIP-seq
MIRT1073789	hsa-miR-3666	CLIP-seq
MIRT2250103	hsa-miR-4284	CLIP-seq
MIRT1073792	hsa-miR-4295	CLIP-seq
MIRT1073794	hsa-miR-4423-5p	CLIP-seq
MIRT2452002	hsa-miR-4430	CLIP-seq
MIRT1073802	hsa-miR-454	CLIP-seq
MIRT2250106	hsa-miR-4772-3p	CLIP-seq
MIRT2389517	hsa-miR-652	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
RFX1	Unknown	21192791

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002291	Process	T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell	IMP	2477710
GO:0005515	Function	Protein binding	IPI	11544294, 11812992, 12208882, 12526797, 15946252, 16595626, 18985028, 22956999, 29100055
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006909	Process	Phagocytosis	IEA
GO:0006954	Process	Inflammatory response	NAS	8103515
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	NAS	2537322, 8103515
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IMP	2477710
GO:0007159	Process	Leukocyte cell-cell adhesion	IEA
GO:0007159	Process	Leukocyte cell-cell adhesion	IMP	2477710, 11812992
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	IMP	19029120
GO:0007160	Process	Cell-matrix adhesion	NAS	19693543
GO:0007165	Process	Signal transduction	NAS	8103515
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	19693543
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	NAS	8103515
GO:0008305	Component	Integrin complex	TAS	2537322
GO:0009986	Component	Cell surface	HDA	23981064
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	19029120, 19234460
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0030369	Function	ICAM-3 receptor activity	IMP	19029120
GO:0030667	Component	Secretory granule membrane	IEA
GO:0034687	Component	Integrin alphaL-beta2 complex	IBA
GO:0034687	Component	Integrin alphaL-beta2 complex	IDA	19029120
GO:0034687	Component	Integrin alphaL-beta2 complex	NAS	19693543
GO:0035579	Component	Specific granule membrane	TAS
GO:0035683	Process	Memory T cell extravasation	IDA	11812992
GO:0038023	Function	Signaling receptor activity	IBA
GO:0042110	Process	T cell activation	IEA
GO:0043113	Process	Receptor clustering	IMP	19029120
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	IMP	19029120
GO:0050839	Function	Cell adhesion molecule binding	IPI	1448173
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098609	Process	Cell-cell adhesion	ISS	12652296

MIM	HGNC	e!Ensembl
153370	6148	ENSG00000005844

P20701

Protein name

Integrin alpha-L (CD11 antigen-like family member A) (Leukocyte adhesion glycoprotein LFA-1 alpha chain) (LFA-1A) (Leukocyte function-associated molecule 1 alpha chain) (CD antigen CD11a)

Protein function

Integrin ITGAL/ITGB2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrin ITGAL/ITGB2 is a receptor for F11R (PubMed:11812992, PubMed:15528364). Integrin ITGAL/ITGB2 is a receptor for the secreted form of ubiquitin-like protein ISG15; the i

PDB

1CQP , 1DGQ , 1LFA , 1MJN , 1MQ8 , 1MQ9 , 1MQA , 1RD4 , 1T0P , 1XDD , 1XDG , 1XUO , 1ZON , 1ZOO , 1ZOP , 2ICA , 2K8O , 2M3E , 2O7N , 3BN3 , 3BQM , 3BQN , 3E2M , 3EOA , 3EOB , 3F74 , 3F78 , 3HI6 , 3M6F , 3TCX , 4IXD , 5E6R , 5E6S , 5E6U , 6BXB , 6BXF , 6BXJ , 6CKB , 7KC3 , 7KC5 , 7KC6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00092	VWA	156 → 326	von Willebrand factor type A domain	Domain
PF01839	FG-GAP	521 → 554	FG-GAP repeat	Repeat
PF08441	Integrin_alpha2	612 → 1002	Integrin alpha	Family
PF00357	Integrin_alpha	1113 → 1127	Integrin alpha cytoplasmic region	Family

Tissue specificity

TISSUE SPECIFICITY: Leukocytes. {ECO:0000269|PubMed:16301335, ECO:0000269|PubMed:23775590}.

Sequence

MKDSCITVMAMALLSGFFFFAPASSYNLDVRGARSFSPPRAGRHFGYRVLQVGNGVIVGA
PGEGNSTGSLYQCQSGTGHCLPVTLRGSNYTSKYLGMTLATDPTDGSILACDPGLSRTCD
QNTYLSGLCYLFRQNLQGPMLQGRPGFQECIKGNVDLVFLFDGSMSLQPDEFQKILDFMK
DVMKKLSNTSYQFAAVQFSTSYKTEFDFSDYVKRKDPDALLKHVKHMLLLTNTFGAINYV
ATEVFREELGARPDATKVLIIITDGEATDSGNIDAAKDIIRYIIGIGKHFQTKESQETLH
KFASKPASEFVKILDTFEKLKDLFTELQKKIYVIEGTSKQDLTSFNMELSSSGISADLSR
GHAVVGAVGAKDWAGGFLDLKADLQDDTFIGNEPLTPEVRAGYLGYTVTWLPSRQKTSLL
ASGAPRYQHMGRVLLFQEPQGGGHWSQVQTIHGTQIGSYFGGELCGVDVDQDGETELLLI
GAPLFYGEQRGGRVFIYQRRQLGFEEVSELQGDPGYPLGRFGEAITALTDINGDGLVDVA
VGAPLEEQGAVYIFNGRHGGLSPQPSQRIEGTQVLSGIQWFGRSIHGVKDLEGDGLADVA
VGAESQMIVLSSRPVVDMVTLMSFSPAEIPVHEVECSYSTSNKMKEGVNITICFQIKSLI
PQFQGRLVANLTYTLQLDGHRTRRRGLFPGGRHELRRNIAVTTSMSCTDFSFHFPVCVQD
LISPINVSLNFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEKNCGEDKKCEAN
LRVSFSPARSRALRLTAFASLSVELSLSNLEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQ
IPVSCEELPEESRLLSRALSCNVSSPIFKAGHSVALQMMFNTLVNSSWGDSVELHANVTC
NNEDSDLLEDNSATTIIPILYPINILIQDQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPS
IHDHNIPTLEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLPDAAEPCLPGALFR
CPVVFRQEILVQVIGTLELVGEIEASSMFSLCSSLSISFNSSKHFHLYGSNASLAQVVMK
VDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDS
EQLASGQEAGDPGCLKPLHEKDSESGGGKD

Sequence length

1170

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Cell adhesion molecules Neutrophil extracellular trap formation Natural killer cell mediated cytotoxicity Leukocyte transendothelial migration Regulation of actin cytoskeleton Malaria Staphylococcus aureus infection Human T-cell leukemia virus 1 infection Epstein-Barr virus infection Rheumatoid arthritis Viral myocarditis		Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell Cell surface interactions at the vascular wall Integrin cell surface interactions Neutrophil degranulation RUNX3 Regulates Immune Response and Cell Migration

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Benign	rs11574942	RCV005905985
Clear cell carcinoma of kidney	Benign	rs11574942	RCV005905986
Familial cancer of breast	Benign	rs11574942	RCV005905984
Myoepithelial tumor	Uncertain significance	rs1040873306	RCV002463933
Uterine carcinosarcoma	Benign	rs11574942	RCV005905987
Uterine corpus endometrial carcinoma	Benign	rs11574942	RCV005905988

Show/Hide Text Mining Associations (182)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acrodermatitis	Associate	17324275
Adenocarcinoma	Associate	30720096
Adenocarcinoma of Lung	Associate	37256932
Alzheimer Disease	Associate	25197660
Amyotrophic Lateral Sclerosis	Associate	1347673
Anemia Sickle Cell	Associate	15308324, 21173096
Anthropophobia	Stimulate	34831335
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	33957974
Aortic Valve Calcification of	Associate	35865542
Arthritis Psoriatic	Associate	11310827
Arthritis Reactive	Stimulate	10531076
Arthritis Rheumatoid	Stimulate	10193433
Arthritis Rheumatoid	Inhibit	1575573, 33123735
Asthma	Associate	7596088, 9864003
Ataxia Telangiectasia	Associate	21192791
Autoimmune Diseases	Associate	26884833
Autoimmune enteropathy	Stimulate	1361864
Bacterial Infections	Associate	3899217
Basal Ganglia Diseases	Associate	1698024
Behcet Syndrome	Stimulate	8712863
Bile Duct Diseases	Associate	14606706, 16038038
Biliary Atresia	Associate	7519822
Bronchopulmonary Sequestration	Associate	12952263
Burkitt Lymphoma	Associate	1691936, 20187292
Burkitt Lymphoma	Stimulate	2898508
Carcinogenesis	Associate	37256932
Carcinoma Medullary	Associate	7992839
Carcinoma Non Small Cell Lung	Associate	33754027, 34633989
Carcinoma Non Small Cell Lung	Inhibit	37256932
Carcinoma Squamous Cell	Associate	11459174, 2447190
Carotid Artery Diseases	Associate	34140767
Carotid Stenosis	Associate	37644056
Celiac Disease	Associate	40650227
Central Nervous System Diseases	Associate	1972610
Cholangitis Sclerosing	Associate	7537707
Chromosome 12 12p trisomy	Stimulate	24829201
Chromosome 21 monosomy	Inhibit	1975779
Ciliary Motility Disorders	Associate	20618958
Colitis Ulcerative	Associate	7900941
Colonic Neoplasms	Associate	22083532
Colorectal Neoplasms	Associate	22083532, 31625931
Conjunctivitis Allergic	Associate	9497473
Coronary Artery Disease	Stimulate	12717693, 14695458
Coronary Restenosis	Stimulate	12717693
Coronary Stenosis	Associate	14695458
COVID 19	Associate	34548411
Crohn Disease	Associate	28400196, 40650227, 7900941, 8537050
Cystic Fibrosis	Associate	20618958
Death	Associate	30141208
Dental Caries	Associate	24556642
Dermatitis Atopic 1	Stimulate	9864003
Dermatitis Contact	Associate	1706746
Diabetes Mellitus Type 1	Associate	1675200, 19995711
Diffuse panbronchiolitis	Associate	9030883
Disease	Associate	1562732
Down Syndrome	Associate	1348667, 23450818, 2842253
Drug Hypersensitivity	Associate	21905501
Drug Related Side Effects and Adverse Reactions	Associate	1316791, 1713198
Edema	Stimulate	11514959
Epstein Barr Virus Infections	Associate	1316791, 36519208
Fatigue Syndrome Chronic	Associate	26370228
GATA2 Deficiency	Associate	23583640
Giant Cell Arteritis	Associate	10643715
Glomerulonephritis Membranous	Associate	9551397
Graft vs Host Disease	Associate	1370927
Graves Disease	Associate	7900942
Graves Ophthalmopathy	Associate	7680294, 9158103
Guillain Barre Syndrome	Associate	34763483
Heart Arrest	Stimulate	9211596
Hemangioma Cavernous Central Nervous System	Associate	24430173
Hemorrhage	Associate	31329860
Hepatitis Alcoholic	Associate	1347281
Hepatitis B Chronic	Stimulate	7706478
Histiocytosis Langerhans Cell	Associate	7510455, 7573361
HIV Infections	Associate	10444267, 11134324, 1671082, 7923868, 9665971, 9764606
HIV Infections	Stimulate	12409732, 18538835
Hodgkin Disease	Associate	31582539
Hyperlipoproteinemia Type II	Associate	25903419, 32938406
Hypertension Pregnancy Induced	Stimulate	12648441
Immune System Diseases	Associate	35865542
Immunologic Deficiency Syndromes	Associate	1348667, 23450818
Infections	Associate	11920508, 1316791, 17494076, 31315993, 34465136
Infections	Inhibit	23834268
Infections	Stimulate	7545080
Inflammation	Associate	10453751, 12855590, 17324275, 19995711, 21850266, 24940033, 30141208, 33123735, 40650227, 7519822, 7537707, 7626551, 8103515, 9099932, 9551397
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	10844525
Jaundice	Inhibit	8707129
Leishmaniasis Cutaneous	Associate	21905501
Leprosy	Stimulate	9472661
Leprosy Borderline	Stimulate	9472661
Leprosy Lepromatous	Stimulate	9472661
Leukemia	Inhibit	23450818
Leukemia Hairy Cell	Associate	1352710, 2137355
Leukemia Large Granular Lymphocytic	Associate	23667543
Leukemia Lymphocytic Chronic B Cell	Associate	12827656, 1586717, 20809501, 24829201, 26873628, 3048446, 9885225
Leukemia Lymphoid	Associate	3048446
Leukemia Lymphoma Adult T Cell	Associate	11920508, 18702873, 7662973, 7689874
Leukemia Lymphoma Adult T Cell	Stimulate	9573029
Leukemia Megakaryoblastic Acute	Associate	23450818
Leukemia Myeloid	Associate	12855590, 23450818
Leukemia Myeloid Acute	Associate	10706072, 10882733, 11264180, 23450818
Leukemia Myelomonocytic Acute	Associate	11703324, 23450818
Leukemia Plasma Cell	Associate	21526505
Leukemia Promyelocytic Acute	Associate	15108165
Leukocyte adhesion deficiency type 1	Associate	10712675, 1671082, 1975779, 2464599, 2569026
Leukocyte adhesion deficiency type 1	Inhibit	11714770
Leukocyte Adhesion Deficiency Type III	Associate	21536861, 3899217
Leukocyte Adhesion Deficiency Type III	Inhibit	31329860
Leukocyte Disorders	Associate	7662985
Leukoencephalopathy Progressive Multifocal	Associate	22302546
Liver Cirrhosis	Associate	17036394
Liver Cirrhosis Biliary	Associate	14606706, 16038038, 37844121, 7537707
Lung Neoplasms	Associate	24189400, 26513172
Lupus Erythematosus Systemic	Associate	12115234, 1376122, 18063917, 21192791, 24082908, 2438304, 25986394, 28430662
Lupus Erythematosus Systemic	Stimulate	23029299, 8254055
Lupus Erythematosus Systemic	Inhibit	33282947
Lyme Disease	Associate	11179355, 12571864
Lymphoma	Associate	23583640
Lymphoma B Cell	Associate	1381563, 7742541
Lymphoma B Cell	Stimulate	17053842
Lymphoma Non Hodgkin	Associate	1586717, 2022749, 25948491, 2673591, 3048446
Lymphoproliferative Disorders	Associate	23450818
Malaria	Inhibit	27027867
Melanoma	Associate	23039186, 30872676
Metabolic Syndrome	Associate	35865542
Mouth Diseases	Associate	36906717
Multiple Myeloma	Associate	1562732, 15741217, 17177159, 8103718, 8797890
Multiple Sclerosis	Associate	1972610, 24430173
Multiple Sclerosis Relapsing Remitting	Stimulate	23611040
Muscular Diseases	Associate	9099932
Myelodysplastic Syndromes	Stimulate	15668954
Myeloproliferative Disorders	Associate	23450818
Myeloproliferative Syndrome Transient	Associate	23450818
Myocardial Infarction	Stimulate	15067196
Myocardial Infarction	Associate	9426029
Myositis	Associate	19353432, 9099932
Neoplasm Metastasis	Associate	10882733, 22083532
Neoplasms	Associate	10364287, 11200836, 11857027, 1370201, 1562732, 22083532, 23667543, 26513172, 27340278, 2887833, 30720096, 32812852, 35552271, 36688994, 36906717, 8103718, 8362970 View all (2 more)
Neoplasms	Inhibit	37256932, 38125721
Netherton Syndrome	Associate	7742541
Neurodegenerative Diseases	Associate	25197660
Obesity	Stimulate	36921085
Osteoarthritis	Associate	10531076
Osteogenesis imperfecta type 2B	Associate	7479767
Osteosarcoma	Associate	10849374
Ovarian Neoplasms	Associate	37800814
Pancreatic Neoplasms	Associate	8093857
Papillon Lefevre Disease	Associate	10712675
Periodontitis	Associate	36148415
Plaque Atherosclerotic	Associate	32938406
Pleural Effusion	Associate	24069325
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	10210325
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	10882733
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	11703324
Prostatic Neoplasms Castration Resistant	Associate	30141208
Pulmonary Arterial Hypertension	Associate	18029384
Pulmonary Arterial Hypertension	Stimulate	35960497
Pulmonary Disease Chronic Obstructive	Inhibit	16907910
Pulmonary Disease Chronic Obstructive	Associate	34588774
Purpura Thrombocytopenic Idiopathic	Stimulate	26884833
Renal Insufficiency	Associate	1985691
Scleroderma Systemic	Associate	18029384
Sialadenitis	Associate	7748018
Sjogren's Syndrome	Associate	7748018
Sleep Deprivation	Stimulate	8652825
Soft Tissue Injuries	Associate	1347281
Splenomegaly	Associate	26873628
Squamous Cell Carcinoma of Head and Neck	Associate	37210507
Status Asthmaticus	Associate	16001979, 7596088, 8947066
Stomach Neoplasms	Associate	36519208
Syndrome	Stimulate	10192453
Tertiary Lymphoid Structures	Associate	22083532
Triple Negative Breast Neoplasms	Associate	24982892
Tuberculosis	Associate	16313368
Urinary Bladder Neoplasms	Associate	1353063
Uveitis	Associate	9640196
Vascular Diseases	Associate	19995711
Vasculitis	Associate	8254055
Venous Insufficiency	Associate	10086854
Vitamin D Deficiency	Associate	22083532
von Willebrand Diseases	Associate	7479767
Wiskott Aldrich Syndrome	Associate	1512549

ITGAL (integrin subunit alpha L)