Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3680
Gene name Gene Name - the full gene name approved by the HGNC.	Integrin subunit alpha 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ITGA9
Synonyms (NCBI Gene) Gene synonyms aliases	ALPHA-RLC, ITGA4L, RLC
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3p22.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain,

Show/Hide all(67)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005895	hsa-miR-194-5p	Luciferase reporter assay, qRT-PCR, Western blot	20979124
MIRT041874	hsa-miR-484	CLASH	23622248
MIRT053450	hsa-miR-452-5p	Microarray	23807165
MIRT573157	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT573156	hsa-miR-4639-3p	PAR-CLIP	20371350
MIRT573155	hsa-miR-759	PAR-CLIP	20371350
MIRT573154	hsa-miR-519d-5p	PAR-CLIP	20371350
MIRT573153	hsa-miR-5695	PAR-CLIP	20371350
MIRT573152	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT573151	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT573150	hsa-miR-6794-3p	PAR-CLIP	20371350
MIRT573149	hsa-miR-452-3p	PAR-CLIP	20371350
MIRT573148	hsa-miR-515-5p	PAR-CLIP	20371350
MIRT573147	hsa-miR-519e-5p	PAR-CLIP	20371350
MIRT736034	hsa-miR-148a-3p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	31489579
MIRT573157	hsa-miR-5000-5p	PAR-CLIP	20371350
MIRT573156	hsa-miR-4639-3p	PAR-CLIP	20371350
MIRT573155	hsa-miR-759	PAR-CLIP	20371350
MIRT573154	hsa-miR-519d-5p	PAR-CLIP	20371350
MIRT573153	hsa-miR-5695	PAR-CLIP	20371350
MIRT573152	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT573151	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT573150	hsa-miR-6794-3p	PAR-CLIP	20371350
MIRT573149	hsa-miR-452-3p	PAR-CLIP	20371350
MIRT573148	hsa-miR-515-5p	PAR-CLIP	20371350
MIRT573147	hsa-miR-519e-5p	PAR-CLIP	20371350
MIRT1073725	hsa-miR-1202	CLIP-seq
MIRT1073726	hsa-miR-134	CLIP-seq
MIRT1073727	hsa-miR-194	CLIP-seq
MIRT1073728	hsa-miR-3118	CLIP-seq
MIRT1073729	hsa-miR-3163	CLIP-seq
MIRT1073730	hsa-miR-3164	CLIP-seq
MIRT1073731	hsa-miR-3165	CLIP-seq
MIRT1073732	hsa-miR-3194-5p	CLIP-seq
MIRT1073733	hsa-miR-331-5p	CLIP-seq
MIRT1073734	hsa-miR-340	CLIP-seq
MIRT1073735	hsa-miR-3607-5p	CLIP-seq
MIRT1073736	hsa-miR-369-5p	CLIP-seq
MIRT1073737	hsa-miR-3972	CLIP-seq
MIRT1073738	hsa-miR-4320	CLIP-seq
MIRT1073739	hsa-miR-4456	CLIP-seq
MIRT1073740	hsa-miR-4501	CLIP-seq
MIRT1073741	hsa-miR-548c-3p	CLIP-seq
MIRT1073742	hsa-miR-767-5p	CLIP-seq
MIRT2018206	hsa-miR-346	CLIP-seq
MIRT2018207	hsa-miR-4288	CLIP-seq
MIRT2018208	hsa-miR-632	CLIP-seq
MIRT2018209	hsa-miR-654-3p	CLIP-seq
MIRT2250087	hsa-miR-132	CLIP-seq
MIRT1073727	hsa-miR-194	CLIP-seq
MIRT2250088	hsa-miR-212	CLIP-seq
MIRT1073733	hsa-miR-331-5p	CLIP-seq
MIRT2250089	hsa-miR-4328	CLIP-seq
MIRT2250090	hsa-miR-4446-5p	CLIP-seq
MIRT2437973	hsa-miR-4659a-3p	CLIP-seq
MIRT2437974	hsa-miR-4659b-3p	CLIP-seq
MIRT2437975	hsa-miR-4666-5p	CLIP-seq
MIRT2437976	hsa-miR-664	CLIP-seq
MIRT1073726	hsa-miR-134	CLIP-seq
MIRT1073728	hsa-miR-3118	CLIP-seq
MIRT1073730	hsa-miR-3164	CLIP-seq
MIRT1073735	hsa-miR-3607-5p	CLIP-seq
MIRT2451994	hsa-miR-3650	CLIP-seq
MIRT2451995	hsa-miR-3688-5p	CLIP-seq
MIRT1073740	hsa-miR-4501	CLIP-seq
MIRT2451996	hsa-miR-4772-5p	CLIP-seq
MIRT2451997	hsa-miR-644	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
MEIS1	Unknown	23139255
TBX5	Unknown	23139255

Show/Hide all(27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	35802072
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	IGI	21060781
GO:0007155	Process	Cell adhesion	TAS	8245132
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	NAS	19693543
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	NAS	19693543
GO:0008305	Component	Integrin complex	IEA
GO:0008305	Component	Integrin complex	TAS	8245132
GO:0009925	Component	Basal plasma membrane	IEA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0030593	Process	Neutrophil chemotaxis	IEA
GO:0034679	Component	Integrin alpha9-beta1 complex	IBA
GO:0034679	Component	Integrin alpha9-beta1 complex	IEA
GO:0034679	Component	Integrin alpha9-beta1 complex	IPI	25748048
GO:0034679	Component	Integrin alpha9-beta1 complex	ISS
GO:0038023	Function	Signaling receptor activity	IBA
GO:0045906	Process	Negative regulation of vasoconstriction	IEA
GO:0045906	Process	Negative regulation of vasoconstriction	IMP	35802072
GO:0046872	Function	Metal ion binding	IEA
GO:0098609	Process	Cell-cell adhesion	IBA
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	IEA
GO:0098640	Function	Integrin binding involved in cell-matrix adhesion	ISS

MIM	HGNC	e!Ensembl
603963	6145	ENSG00000144668

Protein

UniProt ID

Q13797

Protein name

Integrin alpha-9 (Integrin alpha-RLC)

Protein function

Integrin alpha-9/beta-1 (ITGA9:ITGB1) is a receptor for VCAM1, cytotactin and osteopontin. It recognizes the sequence A-E-I-D-G-I-E-L in cytotactin. ITGA9:ITGB1 may play a crucial role in SVEP1/polydom-mediated myoblast cell adhesion (By similar

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01839	FG-GAP	304 → 340	FG-GAP repeat	Repeat
PF01839	FG-GAP	364 → 399	FG-GAP repeat	Repeat
PF08441	Integrin_alpha2	459 → 909	Integrin alpha	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in vascular smooth muscle cells (at protein level) (PubMed:35802072). Expressed in the airway epithelium (at protein level) (PubMed:8245132). {ECO:0000269|PubMed:35802072, ECO:0000269|PubMed:8245132}.

Sequence

MGGPAAPRGAGRLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTIKVLNLTDNTYLKLNDEVIM
NRRYTYLGYAVTAGHFSHPSTIDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDNDGFPDVAIGAPKEDDFAGAVYIYHGDAGGIVPQYSMKLSGQKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITVDVSIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFHGKHVPGEIGLNYVLMADVAKKEKGQMPRVYFVLLGETMG
QVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLSEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCRSEDCAADLQLQGKLLLSSMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNTERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ

Sequence length

1035

Interactions

View interactions

	KEGG		Reactome
	PI3K-Akt signaling pathway Focal adhesion ECM-receptor interaction Cell adhesion molecules Regulation of actin cytoskeleton Cytoskeleton in muscle cells Human papillomavirus infection Hypertrophic cardiomyopathy Arrhythmogenic right ventricular cardiomyopathy Dilated cardiomyopathy		Integrin cell surface interactions ECM proteoglycans Signal transduction by L1

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Atrial Fibrillation	Atrial fibrillation	N/A	N/A	GWAS
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	N/A	N/A	GWAS
Schizophrenia	Schizophrenia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (27)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Arthritis Rheumatoid	Associate	29038247
Breast Neoplasms	Associate	21975548, 32420379, 33500458
Carcinoma Non Small Cell Lung	Associate	22491060
Carcinoma Ovarian Epithelial	Associate	30945681
Carcinoma Squamous Cell	Associate	22491060, 23478628
Carotid Artery Diseases	Associate	29595698
COVID 19	Associate	33413422
Glioma	Associate	37096960
Head and Neck Neoplasms	Associate	20412120
Heart Diseases	Associate	23343568
Hydrops Fetalis	Associate	36959127
Intracranial Arteriovenous Malformations	Inhibit	36934253
Liver Cirrhosis	Stimulate	31678370
Lung Neoplasms	Associate	9179494
Lymphangioleiomyomatosis	Associate	33863980
Lymphangioma	Associate	17584927
Lymphedema	Associate	22529953
Nasopharyngeal Carcinoma	Associate	26372814, 32985354
Neoplasm Metastasis	Associate	22491060
Neoplasms	Associate	20412120, 26372814, 26491211, 32985354, 33500458
Neoplasms	Inhibit	21975548, 23478628
Primary Myelofibrosis	Associate	31678370
Prostatic Neoplasms	Associate	26491211
Prostatitis	Associate	26491211
Scleroderma Systemic	Associate	28861129
Squamous Cell Carcinoma of Head and Neck	Associate	20412120
Uterine Cervical Neoplasms	Associate	23478628

ITGA9 (integrin subunit alpha 9)