Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3676
Gene name Gene Name - the full gene name approved by the HGNC.
Integrin subunit alpha 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ITGA4
Synonyms (NCBI Gene) Gene synonyms aliases
CD49D, IA4
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.3
Summary Summary of gene provided in NCBI Entrez Gene.
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT007135 hsa-miR-30c-5p qRT-PCR 23418453
MIRT1073585 hsa-miR-186 CLIP-seq
MIRT1073586 hsa-miR-3171 CLIP-seq
MIRT1073587 hsa-miR-4659a-3p CLIP-seq
MIRT1073588 hsa-miR-4659b-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001968 Function Fibronectin binding IEA
GO:0002387 Process Immune response in gut-associated lymphoid tissue NAS 7687523
GO:0002687 Process Positive regulation of leukocyte migration IEA
GO:0003366 Process Cell-matrix adhesion involved in ameboidal cell migration IMP 23986478
GO:0003823 Function Antigen binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
192975 6140 ENSG00000115232
Protein
UniProt ID P13612
Protein name Integrin alpha-4 (CD49 antigen-like family member D) (Integrin alpha-IV) (VLA-4 subunit alpha) (CD antigen CD49d)
Protein function Integrins alpha-4/beta-1 (VLA-4) and alpha-4/beta-7 are receptors for fibronectin. They recognize one or more domains within the alternatively spliced CS-1 and CS-5 regions of fibronectin. They are also receptors for VCAM1. Integrin alpha-4/beta
PDB 3V4P , 3V4V , 4HKC , 5C7Z , 5FPI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01839 FG-GAP 306 342 FG-GAP repeat Repeat
PF01839 FG-GAP 369 403 FG-GAP repeat Repeat
PF08441 Integrin_alpha2 463 905 Integrin alpha Family
Tissue specificity TISSUE SPECIFICITY: Expressed in vascular smooth muscle cells (at protein level). {ECO:0000269|PubMed:35802072}.
Sequence
MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHS
HGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVN
RTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGT
SDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIMKKTINFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCEVTDNSGVVQLDCSIGYIYVDH
LSRIDISFLLDVSSLSRAEEDLSITVHATCENEEEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVRFLSKTDKRLLYCIKADPHCLNF
LCNFG
KMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVA
HVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNDD
Sequence length 1032
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules
Hematopoietic cell lineage
Leukocyte transendothelial migration
Intestinal immune network for IgA production
Regulation of actin cytoskeleton
Cytoskeleton in muscle cells
Yersinia infection
Leishmaniasis
Human papillomavirus infection
Hypertrophic cardiomyopathy
Arrhythmogenic right ventricular cardiomyopathy
Dilated cardiomyopathy
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Cell surface interactions at the vascular wall
Integrin cell surface interactions
RUNX3 Regulates Immune Response and Cell Migration
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Periodontal Diseases Periodontal disease N/A N/A GWAS
Retinitis Pigmentosa Retinitis pigmentosa N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 30720096
Adenoma Associate 25759530
Agammaglobulinemia Stimulate 25931291
Alzheimer Disease Associate 29769839
Anemia Diamond Blackfan Associate 31157955
Asthma Associate 23160057, 29956778
Breast Neoplasms Associate 24756760, 33500458
Cap Myopathy Associate 19470770
Carcinoma Squamous Cell Associate 28886030
Celiac Disease Associate 19648293