Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3670
Gene name Gene Name - the full gene name approved by the HGNC.
ISL LIM homeobox 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ISL1
Synonyms (NCBI Gene) Gene synonyms aliases
ISLET1, Isl-1
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q11.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the LIM/homeodomain family of transcription factors. The encoded protein binds to the enhancer region of the insulin gene, among others, and may play an important role in regulating insulin gene expression. The encoded protei
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT032141 hsa-let-7d-5p Sequencing 20371350
MIRT438369 hsa-miR-128-3p Luciferase reporter assay 24055866
MIRT438369 hsa-miR-128-3p Luciferase reporter assay 24055866
MIRT438369 hsa-miR-128-3p Luciferase reporter assay 24055866
MIRT438369 hsa-miR-128-3p Luciferase reporter assay 24055866
Transcription factors
Transcription factor Regulation Reference
PAX4 Unknown 15161765
SOX2 Repression 20739473
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IEA
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600366 6132 ENSG00000016082
Protein
UniProt ID P61371
Protein name Insulin gene enhancer protein ISL-1 (Islet-1)
Protein function DNA-binding transcriptional activator. Recognizes and binds to the consensus octamer binding site 5'-ATAATTAA-3' in promoter of target genes. Plays a fundamental role in the gene regulatory network essential for retinal ganglion cell (RGC) diffe
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00412 LIM 17 75 LIM domain Domain
PF00412 LIM 79 135 LIM domain Domain
PF00046 Homeodomain 182 238 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in subsets of neurons of the adrenal medulla and dorsal root ganglion, inner nuclear and ganglion cell layers in the retina, the pineal and some regions of the brain. {ECO:0000269|PubMed:7907017}.
Sequence
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFV
RDGKTYCKRDYIRLY
GIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDV
VERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
SDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
Sequence length 349
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Signaling pathways regulating pluripotency of stem cells   Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Barrett esophagus Barrett's esophagus N/A N/A GWAS
Bladder Exstrophy And Epispadias Complex Bladder exstrophy-epispadias-cloacal extrophy complex N/A N/A ClinVar
Insomnia Insomnia N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Amyotrophic Lateral Sclerosis Stimulate 23341441
Aortic Dissection Associate 36959563
Breast Neoplasms Associate 27071379
Carcinoma Neuroendocrine Associate 23503646
Carcinoma Small Cell Associate 38538277
Central Nervous System Diseases Associate 36791193
CHARGE Syndrome Associate 37052590
Congenital Hyperinsulinism Associate 34497584
Diabetic Nephropathies Associate 31895808
Double Outlet Right Ventricle Associate 31484864, 34260301, 35870951