ISG20 (interferon stimulated exonuclease gene 20)

Gene

• Entrez ID: 3669
• Gene name: Interferon stimulated exonuclease gene 20
• Gene symbol: ISG20
• Synonyms (NCBI Gene): CD25, HEM45
• Chromosome: 15
• Chromosome location: 15q26.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018907	hsa-miR-335-5p	Microarray	18185580
MIRT024004	hsa-miR-1-3p	Microarray	18668037
MIRT737487	hsa-miR-486-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), qRT-PCR	33939247
MIRT1072604	hsa-miR-3123	CLIP-seq
MIRT1072605	hsa-miR-3925-5p	CLIP-seq
MIRT1072606	hsa-miR-3976	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
SP1	Unknown	10871365
USF1	Unknown	10871365

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000175	Function	3'-5'-RNA exonuclease activity	IDA	11401564
GO:0000932	Component	P-body	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0004518	Function	Nuclease activity	IEA
GO:0004527	Function	Exonuclease activity	IBA
GO:0004527	Function	Exonuclease activity	IEA
GO:0004527	Function	Exonuclease activity	IMP	21036379
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21036379
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS	9235947
GO:0005730	Component	Nucleolus	IDA	16514659
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	16514659, 21036379
GO:0005737	Component	Cytoplasm	IEA
GO:0006259	Process	DNA metabolic process	IEA
GO:0006308	Process	DNA catabolic process	IBA
GO:0006308	Process	DNA catabolic process	IDA	11401564
GO:0006364	Process	RRNA processing	IEA
GO:0006396	Process	RNA processing	IBA
GO:0006401	Process	RNA catabolic process	IBA
GO:0006401	Process	RNA catabolic process	IDA	11401564
GO:0008310	Function	Single-stranded DNA 3'-5' DNA exonuclease activity	IDA	11401564
GO:0008859	Function	Exoribonuclease II activity	IEA
GO:0009615	Process	Response to virus	IDA	12594219
GO:0015030	Component	Cajal body	IDA	16514659
GO:0015030	Component	Cajal body	IEA
GO:0016605	Component	PML body	IDA	9235947
GO:0016787	Function	Hydrolase activity	IEA
GO:0030619	Function	U1 snRNA binding	IDA	16514659
GO:0030620	Function	U2 snRNA binding	IDA	16514659
GO:0034511	Function	U3 snoRNA binding	IDA	16514659
GO:0045071	Process	Negative regulation of viral genome replication	IBA
GO:0045071	Process	Negative regulation of viral genome replication	IMP	21036379
GO:0045087	Process	Innate immune response	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IMP	21036379

Other IDs

• MIM: 604533
• HGNC: 6130
• e!Ensembl: ENSG00000172183

Protein

• UniProt ID: Q96AZ6
• Protein name: Interferon-stimulated gene 20 kDa protein (EC 3.1.13.1) (Estrogen-regulated transcript 45 protein) (Promyelocytic leukemia nuclear body-associated protein ISG20)
• Protein function: Interferon-induced antiviral exoribonuclease that acts mainly on single-stranded RNA (PubMed:11401564, PubMed:12594219, PubMed:16033969). Exhibits antiviral activity against RNA viruses including hepatitis C virus (HCV), hepatitis A virus (HAV)
• PDB: 1WLJ, 7UGB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00929	RNase_T	8 → 162	Exonuclease	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in peripheral blood leukocytes, spleen, thymus, colon and lung. Up regulated by E2 in estrogen receptor-positive breast cancer lines. {ECO:0000269|PubMed:9235947, ECO:0000269|PubMed:9569007}.
• Sequence:

  MAGSREVVAMDCEMVGLGPHRESGLARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVT
  PQHMVGATPFAVARLEILQLLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREA
  KLDHCRRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMELYQISQRIRARRGLPRLAVS
  D

• Sequence length: 181

Pathways

Reactome:

Interferon alpha/beta signaling