Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3665
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon regulatory factor 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IRF7
Synonyms (NCBI Gene) Gene synonyms aliases	IMD39, IRF-7, IRF-7H, IRF7A, IRF7B, IRF7C, IRF7H
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IMD39
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.	IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain g

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs375323253	G>A	Pathogenic	Stop gained, coding sequence variant
rs786205223	A>C	Pathogenic	Missense variant, coding sequence variant

Show/Hide all(3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021215	hsa-miR-146a-5p	Microarray	18057241
MIRT736401	hsa-miR-369-3p	qRT-PCR, Flow cytometry	33679688
MIRT736425	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688

Transcription factors

Show/Hide all(13)

Transcription factor	Regulation	Reference
ATF4	Repression	21148039
BRCA1	Activation	17374731
IRF3	Unknown	20483755
KAT2B	Repression	12374802
NFKB1	Activation	15265881;16982926
NFKB1	Unknown	11877397
PITX1	Repression	12242290
RELA	Activation	15265881;16982926
RELA	Unknown	11877397
SPIB	Repression	22698399
STAT1	Activation	16628196
TNFAIP3	Repression	20392859
YY1	Unknown	22065573

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	9315633
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	17404045
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	17404045
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0002376	Process	Immune system process	IBA	21873635
GO:0002819	Process	Regulation of adaptive immune response	IDA	17404045
GO:0003677	Function	DNA binding	IMP	12374802
GO:0005515	Function	Protein binding	IPI	11943871, 17599067, 18922877, 19176627, 20392859, 21903422, 30833792
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IDA	22065573
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	19176627
GO:0005737	Component	Cytoplasm	IGI	23729669
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006974	Process	Cellular response to DNA damage stimulus	TAS	16979567
GO:0009615	Process	Response to virus	TAS	21490621
GO:0010008	Component	Endosome membrane	TAS
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0019043	Process	Establishment of viral latency	TAS	21490621
GO:0032479	Process	Regulation of type I interferon production	TAS	21490621
GO:0032481	Process	Positive regulation of type I interferon production	TAS
GO:0032607	Process	Interferon-alpha production	ISS
GO:0032608	Process	Interferon-beta production	ISS
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	16127453
GO:0032727	Process	Positive regulation of interferon-alpha production	TAS	16979567
GO:0032728	Process	Positive regulation of interferon-beta production	IMP	22065573
GO:0032728	Process	Positive regulation of interferon-beta production	TAS	16979567
GO:0034124	Process	Regulation of MyD88-dependent toll-like receptor signaling pathway	ISS
GO:0034127	Process	Regulation of MyD88-independent toll-like receptor signaling pathway	ISS
GO:0035666	Process	TRIF-dependent toll-like receptor signaling pathway	TAS
GO:0039530	Process	MDA-5 signaling pathway	TAS	16979567
GO:0045087	Process	Innate immune response	TAS	17404045
GO:0045655	Process	Regulation of monocyte differentiation	TAS	21490621
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	12374802
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	16127453, 17404045
GO:0050776	Process	Regulation of immune response	TAS	21490621
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0060337	Process	Type I interferon signaling pathway	TAS
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000110	Process	Negative regulation of macrophage apoptotic process	TAS	21490621

MIM	HGNC	e!Ensembl
605047	6122	ENSG00000185507

Protein

UniProt ID

Q92985

Protein name

Interferon regulatory factor 7 (IRF-7)

Protein function

Key transcriptional regulator of type I interferon (IFN)-dependent immune responses and plays a critical role in the innate immune response against DNA and RNA viruses (PubMed:28342865, PubMed:28768858). Regulates the transcription of type I IFN

PDB

2O61

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00605	IRF	13 → 125	Interferon regulatory factor transcription factor	Domain
PF10401	IRF-3	287 → 466	Interferon-regulatory factor 3	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed predominantly in spleen, thymus and peripheral blood leukocytes.

Sequence

MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
KAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHK
VYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG
DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAV
ETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE
LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSL
CLSSANSLYDDIECFLMELEQPA

Sequence length

503

Interactions

View interactions

	KEGG		Reactome
	Toll-like receptor signaling pathway NOD-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway Hepatitis C Hepatitis B Measles Influenza A Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Viral carcinogenesis Lipid and atherosclerosis		DEx/H-box helicases activate type I IFN and inflammatory cytokines production Interferon gamma signaling TICAM1-dependent activation of IRF3/IRF7 Interferon alpha/beta signaling TRAF3-dependent IRF activation pathway TRAF6 mediated IRF7 activation Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Immunodeficiency	IMMUNODEFICIENCY 39	rs1565678077, rs121908002, rs1421444086, rs1565688667, rs944235493, rs121918314, rs587776713, rs137852678, rs587776714, rs128620188, rs2147483647, rs1569556522, rs137853331, rs137853332, rs179363866 View all (256 more)	25814066, 9315633

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Unipolar Depression, Major Depressive Disorder	22832429	ClinVar
Systemic lupus erythematosus	Systemic lupus erythematosus		GWAS

Show/Hide Text Mining Associations (83)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	32294625
Alzheimer Disease	Associate	32046242, 38257800
Arthritis Psoriatic	Stimulate	25809693
Asthma	Associate	22112518, 31775040
Asthma	Stimulate	31775040
Astrocytoma	Associate	15367334
Autoimmune Diseases	Associate	26794091, 27630164
Breast Neoplasms	Associate	26597380
Carcinogenesis	Associate	10924517, 21199806
Carcinoma Basal Cell	Stimulate	17508019
Carcinoma Hepatocellular	Associate	37209778
Carcinoma Non Small Cell Lung	Associate	30278439
Chemical and Drug Induced Liver Injury	Associate	38079352
Colonic Neoplasms	Associate	26133168, 33161410
Colorectal Neoplasms	Associate	25350395, 25546690, 31869529
Colorectal Neoplasms	Stimulate	34488791
Coronavirus Infections	Associate	38257800
COVID 19	Associate	32599245, 32706371, 32972995, 33260035, 33780352, 34043590, 34504502, 35114420, 35277538, 35842705, 36685671, 37217661, 38257800
COVID 19	Stimulate	34076249
Cytokine Release Syndrome	Associate	23535064, 25680411
Dermatomyositis	Associate	19877033, 33576578
Diabetes Mellitus	Stimulate	34076249
Diabetes Mellitus Type 1	Associate	23386205
Diabetes Mellitus Type 2	Associate	36527108
Encephalitis	Associate	37097753
Endometrial Neoplasms	Associate	35993041
Epstein Barr Virus Infections	Associate	10627515
Fatigue	Associate	32330594
Frontotemporal Dementia	Associate	30739198
Gallbladder Neoplasms	Inhibit	30886199, 35035811
Glioblastoma	Associate	25680411
Glioma	Associate	25680411, 33902005
Hepatitis Alcoholic	Stimulate	24997224
Hepatitis Chronic	Associate	37209778
Herpes Simplex	Associate	34389779, 34552595, 37097753
HIV Infections	Associate	23535064, 32084337
HIV Infections	Inhibit	32053234
Hodgkin Disease	Associate	35977101
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	26005050
Infections	Associate	19515829, 20395558, 25520509, 25814066
Infections	Inhibit	19880818
Inflammation	Associate	21455993, 24604203, 25680411, 32330594, 35631163, 36269754
Influenza Human	Inhibit	19880818
Influenza Human	Associate	20935192, 24604203, 25814066, 29453856, 31217193
Interferon gamma receptor 1 deficiency	Associate	38079352
Kidney Diseases	Associate	22433914
Leukemia Myeloid Acute	Associate	25476905
Leukemia Myelomonocytic Chronic	Associate	32763828
Li Fraumeni Syndrome	Associate	18505922, 21199806
Lung Neoplasms	Associate	22194884
Lupus Erythematosus Cutaneous	Associate	36212172
Lupus Erythematosus Discoid	Associate	33879674, 36212172
Lupus Erythematosus Systemic	Associate	20112359, 21360504, 22433914, 26005050, 29257335, 29437559, 31790472, 33108347, 35710306
Lupus Erythematosus Systemic	Inhibit	35757684
Lymphangioleiomyomatosis	Associate	25476905
Lymphoma	Associate	11884566, 17393359
Lymphoma Follicular	Associate	17393359
Microscopic Polyangiitis	Associate	23690996, 28569178
Mixed Connective Tissue Disease	Associate	31440254
Mouth Diseases	Associate	16077073
Multiple Organ Failure	Associate	34504502
Multiple Sclerosis Relapsing Remitting	Inhibit	27036414
Neoplasm Metastasis	Inhibit	30203045
Neoplasms	Associate	18505922, 19667409, 25680411, 26133168, 26597380, 28981114, 34488791
Neoplasms	Inhibit	24004452
Neoplasms	Stimulate	33902005, 35012444
Neutrophil Immunodeficiency Syndrome	Associate	36269754
Osteosarcoma	Associate	27353415
Pancreatic Neoplasms	Stimulate	35012444
Papillomavirus Infections	Associate	33164635
Periodic fever familial autosomal dominant	Associate	31009059
Pulmonary Disease Chronic Obstructive	Associate	20395558, 31170225
Pulmonary Fibrosis	Associate	35558069
RNA Virus Infections	Stimulate	38257800
Scleroderma Systemic	Associate	25569146
Severe Acute Respiratory Syndrome	Stimulate	37261339
Sjogren's Syndrome	Associate	29504848, 30446998, 37614232
Stomach Neoplasms	Associate	20507321
Tuberculosis	Associate	31843671
Uterine Cervical Dysplasia	Stimulate	34670303
Vascular Diseases	Associate	20154210
Virus Diseases	Stimulate	11943871, 23181789, 27667736
Virus Diseases	Associate	20980251, 20980500, 22194884, 34389779, 37328105

IRF7 (interferon regulatory factor 7)