IRF7 (interferon regulatory factor 7)

Gene
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3665
Gene name Gene Name - the full gene name approved by the HGNC.
Interferon regulatory factor 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IRF7
Synonyms (NCBI Gene) Gene synonyms aliases
IMD39, IRF-7, IRF-7H, IRF7A, IRF7B, IRF7C, IRF7H
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.5
Summary Summary of gene provided in NCBI Entrez Gene.
IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain g
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
SNP ID Visualize variation Clinical significance Consequence
rs375323253 G>A Pathogenic Stop gained, coding sequence variant
rs786205223 A>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT021215 hsa-miR-146a-5p Microarray 18057241
MIRT736401 hsa-miR-369-3p qRT-PCR, Flow cytometry 33679688
MIRT736425 hsa-miR-491-3p qRT-PCR, Flow cytometry 33679688
Transcription factors
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
Transcription factor Regulation Reference
ATF4 Repression 21148039
BRCA1 Activation 17374731
IRF3 Unknown 20483755
KAT2B Repression 12374802
NFKB1 Activation 15265881;16982926
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(69)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 9315633
GO:0000785 Component Chromatin IDA 11473119
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605047 6122 ENSG00000185507
Protein
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q92985
Protein name Interferon regulatory factor 7 (IRF-7)
Protein function Key transcriptional regulator of type I interferon (IFN)-dependent immune responses and plays a critical role in the innate immune response against DNA and RNA viruses (PubMed:28342865, PubMed:28768858). Regulates the transcription of type I IFN
PDB 2O61
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00605 IRF 13 → 125 Interferon regulatory factor transcription factor Domain
PF10401 IRF-3 287 → 466 Interferon-regulatory factor 3 Family
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in spleen, thymus and peripheral blood leukocytes.
Sequence 
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
KAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHK
VYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG
DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAV
ETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE
LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSL
CLSSANSLYDDIECFLMELEQPA
Sequence length 503
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Viral carcinogenesis
Lipid and atherosclerosis 		  DEx/H-box helicases activate type I IFN and inflammatory cytokines production
Interferon gamma signaling
TICAM1-dependent activation of IRF3/IRF7
Interferon alpha/beta signaling
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Immunodeficiency immunodeficiency 39 rs375323253 N/A
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Systemic lupus erythematosus Systemic lupus erythematosus N/A N/A GWAS
Show/Hide Text Mining Associations (83)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32294625
Alzheimer Disease Associate 32046242, 38257800
Arthritis Psoriatic Stimulate 25809693
Asthma Associate 22112518, 31775040
Asthma Stimulate 31775040
Astrocytoma Associate 15367334
Autoimmune Diseases Associate 26794091, 27630164
Breast Neoplasms Associate 26597380
Carcinogenesis Associate 10924517, 21199806
Carcinoma Basal Cell Stimulate 17508019