IRF7 (interferon regulatory factor 7)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 3665
Gene name Interferon regulatory factor 7
Gene symbol IRF7
Synonyms (NCBI Gene)
IMD39IRF-7IRF-7HIRF7AIRF7BIRF7CIRF7H
Chromosome 11
Chromosome location 11p15.5
Summary IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain g
SNPs SNP information provided by dbSNP.
2
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
SNP ID Visualize variation Clinical significance Consequence
rs375323253 G>A Pathogenic Stop gained, coding sequence variant
rs786205223 A>C Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
3
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (3)
miRTarBase ID miRNA Experiments Reference
MIRT021215 hsa-miR-146a-5p Microarray 18057241
MIRT736401 hsa-miR-369-3p qRT-PCRFlow cytometry 33679688
MIRT736425 hsa-miR-491-3p qRT-PCRFlow cytometry 33679688
Transcription factors Transcription factors information provided by TRRUST V2 database.
13
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (13)
Transcription factor Regulation Reference
ATF4 Repression 21148039
BRCA1 Activation 17374731
IRF3 Unknown 20483755
KAT2B Repression 12374802
NFKB1 Activation 15265881;16982926
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
69
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (69)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 9315633
GO:0000785 Component Chromatin IDA 11473119
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605047 6122 ENSG00000185507
Protein Protein information from UniProt database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92985
Protein name Interferon regulatory factor 7 (IRF-7)
Protein function Key transcriptional regulator of type I interferon (IFN)-dependent immune responses and plays a critical role in the innate immune response against DNA and RNA viruses (PubMed:28342865, PubMed:28768858). Regulates the transcription of type I IFN
PDB 2O61
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00605 IRF 13 → 125 Interferon regulatory factor transcription factor Domain
PF10401 IRF-3 287 → 466 Interferon-regulatory factor 3 Family
Tissue specificity TISSUE SPECIFICITY: Expressed predominantly in spleen, thymus and peripheral blood leukocytes.
Sequence 
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
KAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHK
VYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG
DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAV
ETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE
LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSL
CLSSANSLYDDIECFLMELEQPA
Sequence length 503
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Hepatitis C
Hepatitis B
Measles
Influenza A
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Viral carcinogenesis
Lipid and atherosclerosis 		  DEx/H-box helicases activate type I IFN and inflammatory cytokines production
Interferon gamma signaling
TICAM1-dependent activation of IRF3/IRF7
Interferon alpha/beta signaling
TRAF3-dependent IRF activation pathway
TRAF6 mediated IRF7 activation
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
619
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (11)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Adrenocortical carcinoma, hereditary Benign rs12290989 RCV005909694
Cholangiocarcinoma Benign rs12290989 RCV005909696
Familial cancer of breast Benign rs12290989 RCV005909693
Glioma susceptibility 1 Uncertain significance rs200063173 RCV005924068
Show/Hide Text Mining Associations (83)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 32294625
Alzheimer Disease Associate 32046242, 38257800
Arthritis Psoriatic Stimulate 25809693
Asthma Associate 22112518, 31775040
Asthma Stimulate 31775040
Astrocytoma Associate 15367334
Autoimmune Diseases Associate 26794091, 27630164
Breast Neoplasms Associate 26597380
Carcinogenesis Associate 10924517, 21199806
Carcinoma Basal Cell Stimulate 17508019