Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3663
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon regulatory factor 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IRF5
Synonyms (NCBI Gene) Gene synonyms aliases	SLEB10
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune syst

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs2004640	T>G	Pathogenic, risk-factor	Genic upstream transcript variant, splice donor variant, intron variant
rs2070197	T>C	Risk-factor	3 prime UTR variant
rs10954213	G>A	Risk-factor	3 prime UTR variant
rs973851559	T>GG	Risk-factor, pathogenic	Intron variant, genic upstream transcript variant, splice donor variant
rs1432329681	T>-	Risk-factor, pathogenic	Intron variant, genic upstream transcript variant, splice donor variant

Show/Hide all(78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007158	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	23303785
MIRT1071312	hsa-miR-1915	CLIP-seq
MIRT1071313	hsa-miR-296-3p	CLIP-seq
MIRT1071314	hsa-miR-3074-3p	CLIP-seq
MIRT1071315	hsa-miR-3174	CLIP-seq
MIRT1071316	hsa-miR-326	CLIP-seq
MIRT1071317	hsa-miR-330-5p	CLIP-seq
MIRT1071318	hsa-miR-3689a-3p	CLIP-seq
MIRT1071319	hsa-miR-3689c	CLIP-seq
MIRT1071320	hsa-miR-369-3p	CLIP-seq
MIRT1071321	hsa-miR-371-5p	CLIP-seq
MIRT1071322	hsa-miR-371b-5p	CLIP-seq
MIRT1071323	hsa-miR-374a	CLIP-seq
MIRT1071324	hsa-miR-374b	CLIP-seq
MIRT1071325	hsa-miR-3915	CLIP-seq
MIRT1071326	hsa-miR-3928	CLIP-seq
MIRT1071327	hsa-miR-4267	CLIP-seq
MIRT1071328	hsa-miR-4425	CLIP-seq
MIRT1071329	hsa-miR-4652-5p	CLIP-seq
MIRT1071330	hsa-miR-4667-5p	CLIP-seq
MIRT1071331	hsa-miR-4700-5p	CLIP-seq
MIRT1071332	hsa-miR-627	CLIP-seq
MIRT1071333	hsa-miR-637	CLIP-seq
MIRT1071334	hsa-miR-656	CLIP-seq
MIRT1071335	hsa-miR-924	CLIP-seq
MIRT1071336	hsa-miR-2110	CLIP-seq
MIRT1071337	hsa-miR-3150a-3p	CLIP-seq
MIRT1071315	hsa-miR-3174	CLIP-seq
MIRT1071338	hsa-miR-3175	CLIP-seq
MIRT1071321	hsa-miR-371-5p	CLIP-seq
MIRT1071322	hsa-miR-371b-5p	CLIP-seq
MIRT1071325	hsa-miR-3915	CLIP-seq
MIRT1071326	hsa-miR-3928	CLIP-seq
MIRT1071339	hsa-miR-4481	CLIP-seq
MIRT1071340	hsa-miR-4640-5p	CLIP-seq
MIRT1071341	hsa-miR-4642	CLIP-seq
MIRT1071342	hsa-miR-4715-5p	CLIP-seq
MIRT1071343	hsa-miR-4726-5p	CLIP-seq
MIRT1071344	hsa-miR-4745-5p	CLIP-seq
MIRT1071332	hsa-miR-627	CLIP-seq
MIRT1071335	hsa-miR-924	CLIP-seq
MIRT1071345	hsa-miR-939	CLIP-seq
MIRT1550208	hsa-miR-1910	CLIP-seq
MIRT1550209	hsa-miR-455-3p	CLIP-seq
MIRT2017538	hsa-let-7a	CLIP-seq
MIRT2017539	hsa-let-7b	CLIP-seq
MIRT2017540	hsa-let-7c	CLIP-seq
MIRT2017541	hsa-let-7d	CLIP-seq
MIRT2017542	hsa-let-7e	CLIP-seq
MIRT2017543	hsa-let-7f	CLIP-seq
MIRT2017544	hsa-let-7g	CLIP-seq
MIRT2017545	hsa-let-7i	CLIP-seq
MIRT2017546	hsa-miR-1184	CLIP-seq
MIRT2017547	hsa-miR-1202	CLIP-seq
MIRT2017548	hsa-miR-1284	CLIP-seq
MIRT2017549	hsa-miR-1912	CLIP-seq
MIRT2017550	hsa-miR-2467-3p	CLIP-seq
MIRT2017551	hsa-miR-3194-5p	CLIP-seq
MIRT2017552	hsa-miR-337-3p	CLIP-seq
MIRT2017553	hsa-miR-3678-3p	CLIP-seq
MIRT2017554	hsa-miR-3944-5p	CLIP-seq
MIRT2017555	hsa-miR-3972	CLIP-seq
MIRT2017556	hsa-miR-4257	CLIP-seq
MIRT2017557	hsa-miR-4423-3p	CLIP-seq
MIRT2017558	hsa-miR-4458	CLIP-seq
MIRT2017559	hsa-miR-4500	CLIP-seq
MIRT1071340	hsa-miR-4640-5p	CLIP-seq
MIRT2017560	hsa-miR-4691-5p	CLIP-seq
MIRT2017561	hsa-miR-4725-5p	CLIP-seq
MIRT1071343	hsa-miR-4726-5p	CLIP-seq
MIRT2017562	hsa-miR-504	CLIP-seq
MIRT2017563	hsa-miR-98	CLIP-seq
MIRT2552990	hsa-miR-3202	CLIP-seq
MIRT2552991	hsa-miR-3690	CLIP-seq
MIRT2552992	hsa-miR-4254	CLIP-seq
MIRT2552993	hsa-miR-4533	CLIP-seq
MIRT2017560	hsa-miR-4691-5p	CLIP-seq
MIRT2552994	hsa-miR-516a-3p	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
IRF3	Unknown	20483755
SP1	Activation	20127100

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	25326418
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12600985
GO:0002376	Process	Immune system process	IBA
GO:0002376	Process	Immune system process	IEA
GO:0002720	Process	Positive regulation of cytokine production involved in immune response	IDA	29046356
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	18836453, 20237317, 21903422, 21988832, 22995936, 25159141, 32433612
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22412986, 25326418
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	22412986, 25326418
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	25326418
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	25326418
GO:0032481	Process	Positive regulation of type I interferon production	IDA	32433612
GO:0032727	Process	Positive regulation of interferon-alpha production	IDA	22412986
GO:0032728	Process	Positive regulation of interferon-beta production	IDA	22412986
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	22412986
GO:0042802	Function	Identical protein binding	IPI	18836453
GO:0043065	Process	Positive regulation of apoptotic process	IMP	22412986
GO:0043565	Function	Sequence-specific DNA binding	IMP	23332764
GO:0045087	Process	Innate immune response	IEA
GO:0045087	Process	Innate immune response	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12600985, 22412986, 25326418, 32433612
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:0070431	Process	Nucleotide-binding oligomerization domain containing 2 signaling pathway	IDA	22412986
GO:0071224	Process	Cellular response to peptidoglycan	IDA	22412986
GO:0071225	Process	Cellular response to muramyl dipeptide	IDA	22412986
GO:0098586	Process	Cellular response to virus	IDA	29046356
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	22412986
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
607218	6120	ENSG00000128604

Protein

UniProt ID

Q13568

Protein name

Interferon regulatory factor 5 (IRF-5)

Protein function

Transcription factor that plays a critical role in innate immunity by activating expression of type I interferon (IFN) IFNA and INFB and inflammatory cytokines downstream of endolysosomal toll-like receptors TLR7, TLR8 and TLR9 (PubMed:11303025,

PDB

3DSH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00605	IRF	16 → 121	Interferon regulatory factor transcription factor	Domain
PF10401	IRF-3	247 → 431	Interferon-regulatory factor 3	Family

Sequence

MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGD
NTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEV
CSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQ
PPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLI
SPHMLPLTDLEIKFQYRGRPPRALTISNPHGCRLFYSQLEATQEQVELFGPISLEQVRFP
SPEDIPSDKQRFYTNQLLDVLDRGLILQLQGQDLYAIRLCQCKVFWSGPCASAHDSCPNP
IQREVKTKLFSLEHFLNELILFQKGQTNTPPPFEIFFCFGEEWPDRKPREKKLITVQVVP
VAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKELHHIWQSQQRLQPVAQAPPG
AGLGVGQGPWPMHPAGMQ

Sequence length

498

Interactions

View interactions

	KEGG		Reactome
	Toll-like receptor signaling pathway		Interferon gamma signaling Interferon alpha/beta signaling

Show/Hide Unknown Diseases (14)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Biliary Cholangitis	Primary biliary cholangitis	N/A	N/A	GWAS
Biliary Cirrhosis	Primary biliary cirrhosis	N/A	N/A	GWAS
Diffuse Cutaneous Systemic Sclerosis	Diffuse cutaneous systemic sclerosis	N/A	N/A	GWAS
Gout	Gout	N/A	N/A	GWAS
Hypertension	Hypertension	N/A	N/A	GWAS
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Papillary Renal Carcinoma	Papillary renal cell carcinoma	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Rheumatoid arthritis	rheumatoid arthritis, Rheumatoid arthritis	N/A	N/A	ClinVar, GWAS
Sjogren-Larsson Syndrome	Sjogren-Larsson Syndrome	N/A	N/A	GWAS
Systemic lupus erythematosus	Systemic lupus erythematosus, susceptibility to, 10, systemic lupus erythematosus, Systemic lupus erythematosus, association with susceptibility to, 10, Systemic lupus erythematosus	N/A	N/A	ClinVar, GenCC, GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (102)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenomatous Polyposis Coli	Associate	37716650
Albuminuria	Associate	37978231
Antiphospholipid Syndrome	Associate	19644876
Aortic Aneurysm Abdominal	Associate	38175709
Arthritis Juvenile	Associate	29928998, 30940621
Arthritis Rheumatoid	Associate	17158136, 17599733, 17881657, 18285424, 21807777, 23941291, 25011482, 27092776, 29379122, 31024565, 31169264, 33583939, 36814288, 39953635
Atherosclerosis	Associate	33666161
Autoimmune Diseases	Associate	18285424, 19796918, 20131239, 20639879, 21804190, 22544929, 22674082, 22909381, 23302156, 23616277, 24116155, 24697591, 25084355, 25205108, 26112714 View all (10 more)
Breast Neoplasms	Associate	25649192
Carcinogenesis	Inhibit	22507190
Carcinoma Ductal	Inhibit	25649192
Carcinoma Hepatocellular	Associate	20676325
Carcinoma Hepatocellular	Inhibit	29079574, 29375210
Carcinoma Intraductal Noninfiltrating	Inhibit	25649192
Carcinoma Renal Cell	Associate	28562332
Cardiovascular Diseases	Associate	25011482
CD59 Deficiency	Associate	18045485, 32441646
Chlamydial Pneumonia	Associate	28440293
Cholangitis Sclerosing	Associate	36828809
Chronic recurrent multifocal osteomyelitis	Associate	33628812
Colitis Ulcerative	Associate	17881657, 22257839
Communication Disorders	Stimulate	29847542
Coronary Artery Disease	Associate	24699314, 33802675
COVID 19	Associate	33440148, 35114420
Crohn Disease	Associate	17881657, 22257839
Death	Associate	22800185
Dermatomyositis	Associate	25337792
Diabetes Mellitus Type 2	Associate	32806763, 36552771
Digestive System Neoplasms	Associate	39993973
Endometrial Neoplasms	Associate	35993041
Epstein Barr Virus Infections	Stimulate	17609264
Esophageal Neoplasms	Associate	39993973
Familial Primary Pulmonary Hypertension	Associate	36899621
Fatigue Syndrome Chronic	Associate	32328064
Fibrosis	Associate	29079574
Glioma	Stimulate	33902005
Hepatitis B Chronic	Associate	29375210
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	25649192
HIV Seropositivity	Associate	22088620
Hyperglycemia	Associate	32806763
Hypoalphalipoproteinemias	Associate	33802675
Hypothyroidism	Associate	33802675
Hypoxia	Inhibit	34108245
Infections	Associate	29847542
Inflammation	Associate	18200047, 22544929, 23275442, 25337792, 28578407, 29867973, 31024565, 31122533, 31718015, 32188105, 32806763, 33802675, 39953635
Inflammatory Bowel Diseases	Associate	17881657, 18285424, 22257839, 28578407
Influenza Human	Associate	29847542
Insulin Resistance	Associate	32188105
Insulin Resistance	Stimulate	32806763
Kidney Diseases	Associate	23023776
Laryngeal Neoplasms	Associate	36033826
Li Fraumeni Syndrome	Associate	18505922
Liver Cirrhosis	Associate	29375210
Liver Cirrhosis Biliary	Associate	20639879, 20639880, 25205108
Lung Diseases Interstitial	Associate	22440820, 25337792
Lung Neoplasms	Associate	22194884
Lupus Erythematosus Cutaneous	Associate	19758313
Lupus Erythematosus Discoid	Associate	19758313
Lupus Erythematosus Systemic	Associate	15657875, 17133578, 17158136, 17189288, 17389033, 17393452, 17412832, 17557928, 17881657, 18050197, 18050247, 18200047, 18204446, 18285424, 18311811 View all (38 more)
Lupus Erythematosus Systemic	Stimulate	20112383, 23349905, 28525378, 32730703
Lymphohistiocytosis Hemophagocytic	Associate	32517705
Lymphoma Primary Effusion	Associate	19129183
Macrophage Activation Syndrome	Associate	31718015
Macular Edema	Associate	24116155
Magnesium Deficiency	Associate	33802675
Melanoma	Associate	22909381
Multiple Sclerosis	Associate	18285424, 28578407
Myasthenia Gravis	Associate	23049601
Myositis	Associate	25337792
Neonatal Systemic lupus erythematosus	Associate	22674082
Neoplasm Metastasis	Associate	22909381, 25649192
Neoplasms	Inhibit	17609264, 26646564, 29079574
Neoplasms	Associate	19028697, 20676325, 22194884, 22507190, 35012444
Neoplasms Adipose Tissue	Associate	31718015
Nonsyndromic Deafness	Associate	22674082
Obesity	Stimulate	31718015, 32188105
Pancreatic Neoplasms	Associate	35012444, 35362545
Pneumonia	Associate	29847542
Polymyositis	Associate	25337792
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	22257839
Positive Pressure Respiration Intrinsic	Associate	22088620
Prostatic Neoplasms	Associate	33934205
Psoriasis	Associate	18200047
Pulmonary Fibrosis	Associate	19116937, 19644887
Renal Insufficiency Chronic	Associate	37978231
Reoviridae Infections	Associate	19565491
Rheumatic Diseases	Associate	25011482
Scleroderma Systemic	Associate	19116937, 19644887, 19796918, 19877059, 20383147, 22440820, 23372721, 31024565, 31421124, 31916109, 31980060
Severe Acute Respiratory Syndrome	Associate	31916109
Sjogren's Syndrome	Associate	18050197, 19116937, 19565491, 22674082, 23302156, 24097067, 28076899, 28578407, 31169264, 36814288
Sjogren's Syndrome	Stimulate	38016737
Spondylitis Ankylosing	Associate	33369221
Squamous Cell Carcinoma of Head and Neck	Associate	35664436
Stomach Neoplasms	Inhibit	20507321
Stroke	Associate	39953635
Thrombocytopenia	Associate	30168487
Thyroid Neoplasms	Associate	22507190
Thyroiditis Subacute	Associate	22507190
Uveitis	Associate	24116155
Uveitis Anterior	Associate	24116155
Virus Diseases	Associate	22194884, 22507190, 28578407
Warburg Sjo Fledelius syndrome	Associate	37978231

IRF5 (interferon regulatory factor 5)