Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3662
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon regulatory factor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IRF4
Synonyms (NCBI Gene) Gene synonyms aliases	IMD131, LSIRF, MUM1, NF-EM5, SHEP8
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IMD131
Chromosome Chromosome number	6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	6p25.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene belongs to the IRF (interferon regulatory factor) family of transcription factors, characterized by an unique tryptophan pentad repeat DNA-binding domain. The IRFs are important in the regulation of interferons in response

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs12203592	C>T	Affects	Intron variant

Show/Hide all(352)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004534	hsa-miR-125b-5p	qRT-PCR, Luciferase reporter assay	20497960
MIRT504380	hsa-miR-574-3p	HITS-CLIP	21572407
MIRT504379	hsa-miR-3943	HITS-CLIP	21572407
MIRT504378	hsa-miR-1324	HITS-CLIP	21572407
MIRT504377	hsa-miR-1199-5p	HITS-CLIP	21572407
MIRT504376	hsa-miR-6751-3p	HITS-CLIP	21572407
MIRT504375	hsa-miR-1225-3p	HITS-CLIP	21572407
MIRT504374	hsa-miR-1233-3p	HITS-CLIP	21572407
MIRT218940	hsa-miR-6847-3p	HITS-CLIP	21572407
MIRT504380	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT504379	hsa-miR-3943	PAR-CLIP	20371350
MIRT504378	hsa-miR-1324	PAR-CLIP	20371350
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	20371350
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	20371350
MIRT169110	hsa-miR-4319	PAR-CLIP	20371350
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	20371350
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	20371350
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT504373	hsa-miR-4313	PAR-CLIP	20371350
MIRT504380	hsa-miR-574-3p	PAR-CLIP	21572407
MIRT504379	hsa-miR-3943	PAR-CLIP	21572407
MIRT504378	hsa-miR-1324	PAR-CLIP	21572407
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	21572407
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	21572407
MIRT169110	hsa-miR-4319	PAR-CLIP	21572407
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	21572407
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	21572407
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	21572407
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	21572407
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	21572407
MIRT504380	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT504379	hsa-miR-3943	PAR-CLIP	23446348
MIRT504378	hsa-miR-1324	PAR-CLIP	23446348
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT169110	hsa-miR-4319	PAR-CLIP	23446348
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	23446348
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	23446348
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT504373	hsa-miR-4313	PAR-CLIP	23446348
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT504380	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT504379	hsa-miR-3943	PAR-CLIP	23446348
MIRT504378	hsa-miR-1324	PAR-CLIP	23446348
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT169110	hsa-miR-4319	PAR-CLIP	23446348
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	23446348
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	23446348
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT504373	hsa-miR-4313	PAR-CLIP	23446348
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT497330	hsa-miR-497-3p	PAR-CLIP	22291592
MIRT497329	hsa-miR-4678	PAR-CLIP	22291592
MIRT169035	hsa-miR-6792-5p	PAR-CLIP	22291592
MIRT218949	hsa-miR-331-5p	PAR-CLIP	22291592
MIRT401842	hsa-miR-4503	PAR-CLIP	22291592
MIRT169058	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT169067	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT169059	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT169070	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT168937	hsa-miR-26a-5p	HITS-CLIP	22473208
MIRT168938	hsa-miR-26b-5p	HITS-CLIP	22473208
MIRT004534	hsa-miR-125b-5p	qRT-PCR	27903272
MIRT735049	hsa-miR-155-5p	Microarray	32990751
MIRT504380	hsa-miR-574-3p	HITS-CLIP	21572407
MIRT504379	hsa-miR-3943	HITS-CLIP	21572407
MIRT504378	hsa-miR-1324	HITS-CLIP	21572407
MIRT504377	hsa-miR-1199-5p	HITS-CLIP	21572407
MIRT504376	hsa-miR-6751-3p	HITS-CLIP	21572407
MIRT504375	hsa-miR-1225-3p	HITS-CLIP	21572407
MIRT504374	hsa-miR-1233-3p	HITS-CLIP	21572407
MIRT218940	hsa-miR-6847-3p	HITS-CLIP	21572407
MIRT504380	hsa-miR-574-3p	PAR-CLIP	20371350
MIRT504379	hsa-miR-3943	PAR-CLIP	20371350
MIRT504378	hsa-miR-1324	PAR-CLIP	20371350
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	20371350
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	20371350
MIRT169110	hsa-miR-4319	PAR-CLIP	20371350
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	20371350
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	20371350
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT504373	hsa-miR-4313	PAR-CLIP	20371350
MIRT504380	hsa-miR-574-3p	PAR-CLIP	21572407
MIRT504379	hsa-miR-3943	PAR-CLIP	21572407
MIRT504378	hsa-miR-1324	PAR-CLIP	21572407
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	21572407
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	21572407
MIRT169110	hsa-miR-4319	PAR-CLIP	21572407
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	21572407
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	21572407
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	21572407
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	21572407
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	21572407
MIRT504380	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT504379	hsa-miR-3943	PAR-CLIP	23446348
MIRT504378	hsa-miR-1324	PAR-CLIP	23446348
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT169110	hsa-miR-4319	PAR-CLIP	23446348
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	23446348
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	23446348
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT504373	hsa-miR-4313	PAR-CLIP	23446348
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT504380	hsa-miR-574-3p	PAR-CLIP	23446348
MIRT504379	hsa-miR-3943	PAR-CLIP	23446348
MIRT504378	hsa-miR-1324	PAR-CLIP	23446348
MIRT169069	hsa-miR-125a-5p	PAR-CLIP	23446348
MIRT004534	hsa-miR-125b-5p	PAR-CLIP	23446348
MIRT169110	hsa-miR-4319	PAR-CLIP	23446348
MIRT504377	hsa-miR-1199-5p	PAR-CLIP	23446348
MIRT504376	hsa-miR-6751-3p	PAR-CLIP	23446348
MIRT504375	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT504374	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT504373	hsa-miR-4313	PAR-CLIP	23446348
MIRT218940	hsa-miR-6847-3p	PAR-CLIP	23446348
MIRT497330	hsa-miR-497-3p	PAR-CLIP	22291592
MIRT497329	hsa-miR-4678	PAR-CLIP	22291592
MIRT169035	hsa-miR-6792-5p	PAR-CLIP	22291592
MIRT218949	hsa-miR-331-5p	PAR-CLIP	22291592
MIRT401842	hsa-miR-4503	PAR-CLIP	22291592
MIRT1071207	hsa-miR-103a	CLIP-seq
MIRT1071208	hsa-miR-107	CLIP-seq
MIRT1071209	hsa-miR-1228	CLIP-seq
MIRT1071210	hsa-miR-1262	CLIP-seq
MIRT1071211	hsa-miR-127-5p	CLIP-seq
MIRT1071212	hsa-miR-1293	CLIP-seq
MIRT1071213	hsa-miR-1298	CLIP-seq
MIRT1071214	hsa-miR-15a	CLIP-seq
MIRT1071215	hsa-miR-15b	CLIP-seq
MIRT1071216	hsa-miR-16	CLIP-seq
MIRT1071217	hsa-miR-195	CLIP-seq
MIRT1071218	hsa-miR-24	CLIP-seq
MIRT1071219	hsa-miR-3122	CLIP-seq
MIRT1071220	hsa-miR-3130-5p	CLIP-seq
MIRT1071221	hsa-miR-3160-3p	CLIP-seq
MIRT1071222	hsa-miR-3171	CLIP-seq
MIRT1071223	hsa-miR-342-3p	CLIP-seq
MIRT1071224	hsa-miR-3682-5p	CLIP-seq
MIRT1071225	hsa-miR-3689d	CLIP-seq
MIRT1071226	hsa-miR-3913-5p	CLIP-seq
MIRT1071227	hsa-miR-424	CLIP-seq
MIRT1071228	hsa-miR-4264	CLIP-seq
MIRT1071229	hsa-miR-4284	CLIP-seq
MIRT1071230	hsa-miR-4320	CLIP-seq
MIRT1071231	hsa-miR-4328	CLIP-seq
MIRT1071232	hsa-miR-433	CLIP-seq
MIRT1071233	hsa-miR-4422	CLIP-seq
MIRT1071234	hsa-miR-4482	CLIP-seq
MIRT1071235	hsa-miR-4483	CLIP-seq
MIRT1071236	hsa-miR-4487	CLIP-seq
MIRT1071237	hsa-miR-450b-3p	CLIP-seq
MIRT1071238	hsa-miR-4520a-3p	CLIP-seq
MIRT1071239	hsa-miR-4638-3p	CLIP-seq
MIRT1071240	hsa-miR-4681	CLIP-seq
MIRT1071241	hsa-miR-4701-3p	CLIP-seq
MIRT1071242	hsa-miR-4760-3p	CLIP-seq
MIRT1071243	hsa-miR-4797-3p	CLIP-seq
MIRT1071244	hsa-miR-4803	CLIP-seq
MIRT1071245	hsa-miR-495	CLIP-seq
MIRT1071246	hsa-miR-497	CLIP-seq
MIRT1071247	hsa-miR-513a-3p	CLIP-seq
MIRT1071248	hsa-miR-548a-3p	CLIP-seq
MIRT1071249	hsa-miR-548ae	CLIP-seq
MIRT1071250	hsa-miR-548aj	CLIP-seq
MIRT1071251	hsa-miR-548am	CLIP-seq
MIRT1071252	hsa-miR-548c-3p	CLIP-seq
MIRT1071253	hsa-miR-548e	CLIP-seq
MIRT1071254	hsa-miR-548f	CLIP-seq
MIRT1071255	hsa-miR-548x	CLIP-seq
MIRT1071256	hsa-miR-558	CLIP-seq
MIRT1071257	hsa-miR-587	CLIP-seq
MIRT1071258	hsa-miR-592	CLIP-seq
MIRT1071259	hsa-miR-597	CLIP-seq
MIRT1071260	hsa-miR-599	CLIP-seq
MIRT1071261	hsa-miR-602	CLIP-seq
MIRT1071262	hsa-miR-668	CLIP-seq
MIRT1071263	hsa-miR-769-3p	CLIP-seq
MIRT1071264	hsa-miR-9	CLIP-seq
MIRT1071265	hsa-miR-1270	CLIP-seq
MIRT1071266	hsa-miR-1305	CLIP-seq
MIRT1071267	hsa-miR-2116	CLIP-seq
MIRT1071268	hsa-miR-300	CLIP-seq
MIRT1071219	hsa-miR-3122	CLIP-seq
MIRT1071269	hsa-miR-3124-3p	CLIP-seq
MIRT1071270	hsa-miR-3192	CLIP-seq
MIRT1071271	hsa-miR-3611	CLIP-seq
MIRT1071272	hsa-miR-3653	CLIP-seq
MIRT1071273	hsa-miR-3658	CLIP-seq
MIRT1071274	hsa-miR-3685	CLIP-seq
MIRT1071225	hsa-miR-3689d	CLIP-seq
MIRT1071275	hsa-miR-376c	CLIP-seq
MIRT1071276	hsa-miR-381	CLIP-seq
MIRT1071277	hsa-miR-384	CLIP-seq
MIRT1071226	hsa-miR-3913-5p	CLIP-seq
MIRT1071278	hsa-miR-4271	CLIP-seq
MIRT1071279	hsa-miR-4277	CLIP-seq
MIRT1071280	hsa-miR-432	CLIP-seq
MIRT1071230	hsa-miR-4320	CLIP-seq
MIRT1071281	hsa-miR-4434	CLIP-seq
MIRT1071282	hsa-miR-4495	CLIP-seq
MIRT1071283	hsa-miR-4496	CLIP-seq
MIRT1071237	hsa-miR-450b-3p	CLIP-seq
MIRT1071284	hsa-miR-4516	CLIP-seq
MIRT1071285	hsa-miR-4531	CLIP-seq
MIRT1071286	hsa-miR-4643	CLIP-seq
MIRT1071287	hsa-miR-466	CLIP-seq
MIRT1071288	hsa-miR-4662a-3p	CLIP-seq
MIRT1071289	hsa-miR-4666-3p	CLIP-seq
MIRT1071290	hsa-miR-4709-3p	CLIP-seq
MIRT1071291	hsa-miR-4716-3p	CLIP-seq
MIRT1071292	hsa-miR-4725-3p	CLIP-seq
MIRT1071293	hsa-miR-4728-3p	CLIP-seq
MIRT1071294	hsa-miR-4789-3p	CLIP-seq
MIRT1071295	hsa-miR-4793-3p	CLIP-seq
MIRT1071296	hsa-miR-4795-5p	CLIP-seq
MIRT1071297	hsa-miR-4800-5p	CLIP-seq
MIRT1071298	hsa-miR-501-3p	CLIP-seq
MIRT1071299	hsa-miR-501-5p	CLIP-seq
MIRT1071300	hsa-miR-502-3p	CLIP-seq
MIRT1071301	hsa-miR-508-5p	CLIP-seq
MIRT1071302	hsa-miR-576-3p	CLIP-seq
MIRT1071258	hsa-miR-592	CLIP-seq
MIRT1071259	hsa-miR-597	CLIP-seq
MIRT1071260	hsa-miR-599	CLIP-seq
MIRT1071303	hsa-miR-607	CLIP-seq
MIRT1071304	hsa-miR-620	CLIP-seq
MIRT1071305	hsa-miR-625	CLIP-seq
MIRT1071306	hsa-miR-642b	CLIP-seq
MIRT1071307	hsa-miR-661	CLIP-seq
MIRT1071262	hsa-miR-668	CLIP-seq
MIRT1071308	hsa-miR-711	CLIP-seq
MIRT1071309	hsa-miR-758	CLIP-seq
MIRT1071310	hsa-miR-766	CLIP-seq
MIRT1071263	hsa-miR-769-3p	CLIP-seq
MIRT1071311	hsa-miR-889	CLIP-seq
MIRT1071264	hsa-miR-9	CLIP-seq
MIRT2017523	hsa-miR-128	CLIP-seq
MIRT2017524	hsa-miR-214	CLIP-seq
MIRT2017525	hsa-miR-27a	CLIP-seq
MIRT2017526	hsa-miR-27b	CLIP-seq
MIRT2017527	hsa-miR-3120-3p	CLIP-seq
MIRT2017528	hsa-miR-3148	CLIP-seq
MIRT2017529	hsa-miR-3614-5p	CLIP-seq
MIRT2017530	hsa-miR-3619-5p	CLIP-seq
MIRT2017531	hsa-miR-4274	CLIP-seq
MIRT2017532	hsa-miR-4428	CLIP-seq
MIRT2017533	hsa-miR-4436b-5p	CLIP-seq
MIRT2017534	hsa-miR-4778-3p	CLIP-seq
MIRT2017535	hsa-miR-513a-5p	CLIP-seq
MIRT2017536	hsa-miR-579	CLIP-seq
MIRT2017537	hsa-miR-761	CLIP-seq
MIRT2249460	hsa-miR-1208	CLIP-seq
MIRT2017523	hsa-miR-128	CLIP-seq
MIRT2249461	hsa-miR-1321	CLIP-seq
MIRT2249462	hsa-miR-1323	CLIP-seq
MIRT2249463	hsa-miR-145	CLIP-seq
MIRT2249464	hsa-miR-1587	CLIP-seq
MIRT2249465	hsa-miR-1825	CLIP-seq
MIRT2249466	hsa-miR-1827	CLIP-seq
MIRT2249467	hsa-miR-199a-5p	CLIP-seq
MIRT2249468	hsa-miR-199b-5p	CLIP-seq
MIRT2249469	hsa-miR-204	CLIP-seq
MIRT2249470	hsa-miR-211	CLIP-seq
MIRT2249471	hsa-miR-2115	CLIP-seq
MIRT2017525	hsa-miR-27a	CLIP-seq
MIRT2017526	hsa-miR-27b	CLIP-seq
MIRT2017528	hsa-miR-3148	CLIP-seq
MIRT2249472	hsa-miR-3153	CLIP-seq
MIRT1071221	hsa-miR-3160-3p	CLIP-seq
MIRT2249473	hsa-miR-3180-5p	CLIP-seq
MIRT2249474	hsa-miR-3616-3p	CLIP-seq
MIRT2249475	hsa-miR-3647-3p	CLIP-seq
MIRT2249476	hsa-miR-3671	CLIP-seq
MIRT2249477	hsa-miR-370	CLIP-seq
MIRT2249478	hsa-miR-371b-5p	CLIP-seq
MIRT2249479	hsa-miR-3929	CLIP-seq
MIRT2249480	hsa-miR-4270	CLIP-seq
MIRT2249481	hsa-miR-4324	CLIP-seq
MIRT2249482	hsa-miR-4419b	CLIP-seq
MIRT1071233	hsa-miR-4422	CLIP-seq
MIRT2017532	hsa-miR-4428	CLIP-seq
MIRT2249483	hsa-miR-4436b-3p	CLIP-seq
MIRT2249484	hsa-miR-4441	CLIP-seq
MIRT2249485	hsa-miR-4459	CLIP-seq
MIRT2249486	hsa-miR-4478	CLIP-seq
MIRT1071236	hsa-miR-4487	CLIP-seq
MIRT2249487	hsa-miR-4492	CLIP-seq
MIRT2249488	hsa-miR-4498	CLIP-seq
MIRT2249489	hsa-miR-4505	CLIP-seq
MIRT2249490	hsa-miR-4635	CLIP-seq
MIRT2249491	hsa-miR-4646-5p	CLIP-seq
MIRT2249492	hsa-miR-4649-3p	CLIP-seq
MIRT2249493	hsa-miR-4656	CLIP-seq
MIRT2249494	hsa-miR-4668-5p	CLIP-seq
MIRT2249495	hsa-miR-4674	CLIP-seq
MIRT2249496	hsa-miR-4675	CLIP-seq
MIRT2249497	hsa-miR-4695-5p	CLIP-seq
MIRT2249498	hsa-miR-4699-3p	CLIP-seq
MIRT2249499	hsa-miR-4722-5p	CLIP-seq
MIRT2249500	hsa-miR-4739	CLIP-seq
MIRT2249501	hsa-miR-4741	CLIP-seq
MIRT2249502	hsa-miR-4755-5p	CLIP-seq
MIRT2249503	hsa-miR-4756-5p	CLIP-seq
MIRT2249504	hsa-miR-4768-3p	CLIP-seq
MIRT1071295	hsa-miR-4793-3p	CLIP-seq
MIRT2249505	hsa-miR-4793-5p	CLIP-seq
MIRT2249506	hsa-miR-485-5p	CLIP-seq
MIRT1071301	hsa-miR-508-5p	CLIP-seq
MIRT1071247	hsa-miR-513a-3p	CLIP-seq
MIRT2249507	hsa-miR-516a-3p	CLIP-seq
MIRT2249508	hsa-miR-520a-5p	CLIP-seq
MIRT2249509	hsa-miR-525-5p	CLIP-seq
MIRT2249510	hsa-miR-541	CLIP-seq
MIRT2249511	hsa-miR-548an	CLIP-seq
MIRT2249512	hsa-miR-548o	CLIP-seq
MIRT1071256	hsa-miR-558	CLIP-seq
MIRT2249513	hsa-miR-590-3p	CLIP-seq
MIRT2249514	hsa-miR-623	CLIP-seq
MIRT2249515	hsa-miR-651	CLIP-seq
MIRT2249516	hsa-miR-654-5p	CLIP-seq
MIRT2249517	hsa-miR-658	CLIP-seq
MIRT2249518	hsa-miR-762	CLIP-seq
MIRT1071310	hsa-miR-766	CLIP-seq
MIRT2249519	hsa-miR-940	CLIP-seq
MIRT2249461	hsa-miR-1321	CLIP-seq
MIRT2249480	hsa-miR-4270	CLIP-seq
MIRT2249484	hsa-miR-4441	CLIP-seq
MIRT2249500	hsa-miR-4739	CLIP-seq
MIRT2249503	hsa-miR-4756-5p	CLIP-seq
MIRT2552980	hsa-miR-1207-3p	CLIP-seq
MIRT2552981	hsa-miR-1301	CLIP-seq
MIRT1071270	hsa-miR-3192	CLIP-seq
MIRT2552982	hsa-miR-3667-5p	CLIP-seq
MIRT2552983	hsa-miR-4432	CLIP-seq
MIRT2552984	hsa-miR-451b	CLIP-seq
MIRT2552985	hsa-miR-4660	CLIP-seq
MIRT2552986	hsa-miR-4696	CLIP-seq
MIRT2552987	hsa-miR-4701-5p	CLIP-seq
MIRT1071295	hsa-miR-4793-3p	CLIP-seq
MIRT2552988	hsa-miR-5047	CLIP-seq
MIRT1071301	hsa-miR-508-5p	CLIP-seq
MIRT2552989	hsa-miR-588	CLIP-seq
MIRT1071307	hsa-miR-661	CLIP-seq
MIRT1071262	hsa-miR-668	CLIP-seq
MIRT1071310	hsa-miR-766	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
BCL6	Repression	10601358
CEBPB	Activation	19717648
NFKB1	Activation	17018379
RELA	Activation	17018379
STAT6	Unknown	10601358

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000786	Component	Nucleosome	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	12374808
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	12374808
GO:0002376	Process	Immune system process	IBA	21873635
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0003700	Function	DNA-binding transcription factor activity	NAS	12374808
GO:0005515	Function	Protein binding	IPI	21903422, 32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005634	Component	Nucleus	IC	12374808
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0008134	Function	Transcription factor binding	NAS	12374808
GO:0016020	Component	Membrane	HDA	19946888
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	12374808
GO:0032736	Process	Positive regulation of interleukin-13 production	IDA	12374808
GO:0032743	Process	Positive regulation of interleukin-2 production	IDA	12374808
GO:0032753	Process	Positive regulation of interleukin-4 production	IDA	12374808
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IEA
GO:0042110	Process	T cell activation	NAS	12374808
GO:0042832	Process	Defense response to protozoan	ISS
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043388	Process	Positive regulation of DNA binding	IEA
GO:0043565	Function	Sequence-specific DNA binding	ISS
GO:0043966	Process	Histone H3 acetylation	IEA
GO:0043967	Process	Histone H4 acetylation	IEA
GO:0045622	Process	Regulation of T-helper cell differentiation	NAS	12374808
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	12374808
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12374808
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0060337	Process	Type I interferon signaling pathway	TAS
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24995979
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
601900	6119	ENSG00000137265

Protein

UniProt ID

Q15306

Protein name

Interferon regulatory factor 4 (IRF-4) (Lymphocyte-specific interferon regulatory factor) (LSIRF) (Multiple myeloma oncogene 1) (NF-EM5)

Protein function

Transcriptional activator. Binds to the interferon-stimulated response element (ISRE) of the MHC class I promoter. Binds the immunoglobulin lambda light chain enhancer, together with PU.1. Probably plays a role in ISRE-targeted signal transducti

PDB

2DLL , 6TD4 , 7JM4 , 7O56 , 7OGS , 7OOT , 7RH2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00605	IRF	23 → 128	Interferon regulatory factor transcription factor	Domain
PF10401	IRF-3	249 → 418	Interferon-regulatory factor 3	Family

Tissue specificity

TISSUE SPECIFICITY: Lymphoid cells.

Sequence

MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQ
DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRD
YVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIR
SAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQ
RKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFD
TQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN
SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Sequence length

451

Interactions

View interactions

	KEGG		Reactome
	Th17 cell differentiation		Interleukin-4 and Interleukin-13 signaling Interferon gamma signaling Interferon alpha/beta signaling

Show/Hide Causal Diseases (6)

Disease term	Disease name	dbSNP ID	References
Causal
Basal cell neoplasm	Basal Cell Neoplasm, Basal Cell Cancer	rs587776578, rs587776579, rs2117956624, rs2118419579, rs2118365442, rs2118041703, rs2136689212, rs2118336503, rs1587692888, rs267606984, rs878853849, rs1554695110, rs1064793921, rs1588605348, rs1588568813	31174203, 27539887
Carcinoma	Basal cell carcinoma, Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	31174203, 27539887, 26829030
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)	30595370
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	28604730
Lymphoma	Lymphoma, T-Cell, Cutaneous	rs11540652, rs1592119138, rs1592123162, rs1599367044	26192916
Multiple myeloma	Multiple Myeloma	rs11540652, rs78311289, rs121913482, rs397507340, rs121913343, rs121913240, rs121913529, rs730882018, rs1057517992, rs121913527, rs756183569, rs746646631, rs1574706907, rs372078034, rs745380962 View all (38 more)	30213928, 18568025

Show/Hide Unknown Diseases (19)

Disease term	Disease name	Evidence	References	Source
Unknown
Asthma	Asthma, Childhood asthma		30929738, 31036433	ClinVar, GWAS
Celiac disease	Celiac Disease, Celiac disease		22057235	ClinVar, GWAS
Nasopharyngeal carcinoma	Nasopharyngeal carcinoma	These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes.	20512145	ClinVar, CBGDA
Alopecia Areata	Alopecia Areata			GWAS
Vitiligo	Vitiligo			GWAS
Rheumatoid arthritis	Rheumatoid arthritis			GWAS
Lymphocytic Leukemia	Lymphocytic Leukemia			GWAS
Schizophrenia	Schizophrenia			GWAS
Progressive Supranuclear Palsy	Progressive Supranuclear Palsy			GWAS
Central Nervous System Lymphoma	Central Nervous System Lymphoma			GWAS
Uveal Melanoma	Uveal Melanoma	Furthermore, knocking-down GPS2 promoted the proliferation and metastatic abilities of UM cells both in vivo and in vitro.		GWAS, CBGDA
Melanoma	Melanoma	SMAD3 and SLC9A5 gain?of?function increases invasion capability of melanoma cells.		GWAS, CBGDA
Inflammatory Bowel Disease	Inflammatory Bowel Disease			GWAS
Crohn Disease	Crohn Disease			GWAS
Nasal polyposis	Nasal polyposis			GWAS
Psoriasis	Psoriasis			GWAS
Lymphoid leukemia	Lymphoid leukemia			GWAS
Dermatitis	Dermatitis			GWAS
Actinic keratosis	Actinic keratosis			GWAS

Show/Hide Text Mining Associations (151)

Disease Name	Relationship Type	References
Associations from Text Mining
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	21114485
Abortion Spontaneous	Stimulate	37035756
Acquired Immunodeficiency Syndrome	Associate	31570354
Agammaglobulinemia	Associate	36917008
Arthralgia	Stimulate	29720240
Arthritis	Stimulate	29720240
Arthritis Rheumatoid	Associate	24213554, 27111665, 28706201, 33004899
Arthritis Rheumatoid	Stimulate	29720240, 30666255
Asthma	Stimulate	30087444
Asthma	Associate	36012391
Ataxia Telangiectasia	Associate	36674612
Atherosclerosis	Associate	25855937
Bone Marrow Diseases	Associate	12393648
Breast Neoplasms	Associate	28251349, 32514046, 36046784
Bronchiolitis Obliterans Syndrome	Associate	28851699
Burkitt Lymphoma	Associate	19144381, 20080768, 35472072
Carcinogenesis	Associate	24970810
Carcinoma	Associate	26429873
Carcinoma Basal Cell	Associate	21270109, 30520188
Carcinoma Hepatocellular	Associate	36461603
Carcinoma Non Small Cell Lung	Associate	27113098
Carcinoma Non Small Cell Lung	Stimulate	28849037
Carcinoma Renal Cell	Associate	40607252
Carcinoma Squamous Cell	Associate	21270109, 27424798, 29054604
Cardiovascular Diseases	Associate	36505471
Central Nervous System Diseases	Associate	34791573
Chromosome 12 12p trisomy	Associate	21791429
Chronic Periodontitis	Associate	37805677
Colitis Ulcerative	Associate	38274809
Colonic Neoplasms	Associate	33161410
Color Vision Defects	Associate	18483556
Colorectal Neoplasms	Associate	24485021, 31558874, 33078631, 33478584
Common Variable Immunodeficiency	Associate	34920653
Coronary Artery Disease	Associate	25855937
COVID 19	Associate	34824360
COVID 19	Inhibit	36333264
Death	Associate	12393648
Dermatomyositis	Associate	27803134
Drug Hypersensitivity	Associate	21919915, 33079489
Drug Related Side Effects and Adverse Reactions	Associate	18987657, 29954751
Endometrial Neoplasms	Associate	33690729, 35993041
Endometritis	Associate	38345444
Epidermal Nevus	Associate	25307738
Epstein Barr Virus Infections	Associate	18417578, 23658517, 25207815, 35472072
Gastritis	Associate	28418867
Giant Cell Arteritis	Associate	34583923
Glioma	Associate	33902005
Hemangioblastoma	Associate	26768750
Hematologic Neoplasms	Associate	23658517, 25207815, 28849037, 34913532
Hereditary leiomyomatosis and renal cell cancer	Associate	19821826
HIV Infections	Associate	31570354
Hodgkin Disease	Associate	11972519, 17768115, 19804451, 19821826, 21114485, 21393330, 21424034, 22955914, 25232062, 32914098, 37935654
Infections	Associate	25207815
Inflammatory Bowel Diseases	Associate	34697723
Insect Bites and Stings	Associate	34622970
Keratosis Actinic	Associate	27646882
Kidney Diseases	Associate	34952945
Leukemia	Associate	12218129, 16396836, 23977280
Leukemia	Stimulate	25207815
Leukemia B Cell	Associate	20855867, 23995111, 27799566
Leukemia Lymphocytic Chronic B Cell	Associate	12079517, 12393648, 20332261, 20731705, 20855867, 21791429, 23708256, 33533913
Leukemia Lymphoid	Associate	19897031
Leukemia Lymphoma Adult T Cell	Associate	12218129, 17138822, 21680528, 28910419, 30032036, 31972002, 34913532, 35675522
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	16396836, 35544467
Leukemia Myeloid Acute	Associate	23977280, 27517498
Leukemia Plasma Cell	Associate	35770320
Leukemia Prolymphocytic T Cell	Associate	19804451, 20553269
Lung Diseases Interstitial	Associate	39808289
Lung Neoplasms	Associate	27113098
Lupus Erythematosus Systemic	Associate	24213554, 26880555, 30666255, 33249782
Lymphoma	Associate	12079517, 18417578, 20118770, 21114485, 21487109, 22041376, 23977280, 23995111, 24970810, 25833963, 26731516, 30305637, 32843547, 35142151, 37935654
Lymphoma	Stimulate	25207815
Lymphoma B Cell	Associate	16778825, 19880780, 19897031, 21487109, 24030746, 31012208, 31292115, 31738823, 31914056, 32239695, 32914098, 36221796, 36810796, 37561599
Lymphoma B Cell Marginal Zone	Associate	34952945
Lymphoma Follicular	Associate	17296585, 21487109, 22102710, 23445872, 26307535, 32239695, 37561599
Lymphoma Large B Cell Diffuse	Associate	12460461, 12907442, 14556665, 17133544, 17149956, 17395602, 19448593, 21487109, 24875472, 26414904, 26869285, 28479318, 31012208, 31738823, 31914056 View all (7 more)
Lymphoma Large Cell Anaplastic	Associate	29588546, 31101622, 31570354, 34791573
Lymphoma Mantle Cell	Associate	20956803, 36282572
Lymphoma Non Hodgkin	Associate	12594241, 19396635, 19897031
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	18987657, 19710685, 21169992, 22388754, 34622970
Lymphoma Primary Effusion	Associate	11091208, 23804715, 24928034, 29954751, 32843547, 33298918, 33411730
Lymphoma Primary Effusion	Inhibit	32817485
Lymphoma T Cell	Associate	34699105
Lymphoma T Cell Peripheral	Associate	18987657, 19710685, 24604141, 25833963
Lymphomatoid Papulosis	Associate	21169992
Lymphoproliferative Disorders	Associate	12907442, 31570354
Mastocytosis Systemic	Inhibit	36333264
Melanoma	Associate	20602913, 21270109, 21962134, 23393597, 23537197, 26857527, 29753029, 30333196, 34293285, 34898573, 34915882, 36219477
Melanoma	Stimulate	25207815
Melanoma Cutaneous Malignant	Associate	21962134
Melanosis	Associate	29190509
Metaplasia	Associate	28418867
Metrorrhagia	Associate	25705849
Microsatellite Instability	Associate	12521125
Multiple Myeloma	Associate	10706878, 12079517, 12200383, 15578069, 17914559, 18987657, 21223249, 21393330, 21454650, 21707574, 22984542, 23541952, 23977280, 25978432, 26269456 View all (25 more)
Multiple Myeloma	Stimulate	25207815
Myasthenia Gravis	Associate	29569949
Mycosis Fungoides	Associate	34699105
Nasal Polyps	Associate	35697826, 37385124
Neoplasm Metastasis	Associate	28251349
Neoplasm Metastasis	Inhibit	30203045
Neoplasms	Associate	18417578, 25817328, 25833963, 26429873, 26470881, 26869285, 31882486, 32843547, 33478584, 33949771, 35012444, 35500227
Neoplasms	Stimulate	27903272, 33902005
Neural crest tumor	Associate	21487109
Neuroendocrine Tumors	Associate	33968055
Nevus	Associate	20602913, 21962134
Nevus Intradermal	Associate	20602913
Oral Submucous Fibrosis	Associate	36797470
Pancreatic Neoplasms	Associate	35012444
Paraplegia	Stimulate	15308563
Paraproteinemias	Associate	36138464
Pemphigus	Associate	33741391
Periodontitis	Associate	23029519, 34859622
Photosensitivity Disorders	Associate	29974532
Pigmentation Disorders	Associate	18483556, 19396635, 21270109, 27646882, 29974532, 34424336
Plasmablastic Lymphoma	Associate	15578069, 26960478, 34465776
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	19897031
Primary Immunodeficiency Diseases	Associate	36917008
Pulmonary Disease Chronic Obstructive	Associate	36012391, 37805677
Purpura Thrombocytopenic Idiopathic	Associate	27662073, 31380412
Pyruvate Carboxylase Deficiency Disease	Associate	19846886, 33133085, 36752202
Rectal Neoplasms	Associate	21859832, 33949771
Rheumatic Heart Disease	Associate	28791349
Rhinitis Allergic	Stimulate	21919915, 26708394
Ring Chromosomes	Associate	36810796
Sarcoidosis Pulmonary	Associate	12521125
Sarcoma Kaposi	Inhibit	32817485
Scleroderma Systemic	Associate	27111665
Severe Acute Respiratory Syndrome	Stimulate	37261339
Severe Combined Immunodeficiency	Associate	37683642
Skin Diseases	Associate	28706201
Skin Neoplasms	Associate	21270109, 23548203, 25705849, 35018451
Splenomegaly	Associate	24604141
Spondylitis Ankylosing	Associate	26452539
Squamous Cell Carcinoma of Head and Neck	Associate	35664436, 37491232
Squamous Cell Carcinoma of Head and Neck	Stimulate	36797470
Status Asthmaticus	Associate	33079489
Stomach Neoplasms	Associate	20507321, 28418867, 35874675
T cell immunodeficiency primary	Associate	35544467
Thrombocytopenia	Associate	31380412
Thyroiditis Autoimmune	Associate	11091208
Uniparental Disomy	Associate	34424336
Urinary Bladder Neoplasms	Associate	32420368
Urticaria Solar	Associate	26857527
Uterine Cervical Neoplasms	Associate	34020619, 36308358
Uveal melanoma	Associate	34424336
Virus Diseases	Associate	32631904
Vitiligo	Associate	28129744
Waldenstrom Macroglobulinemia	Associate	30305637
Whipple Disease	Associate	29537367
X Linked Combined Immunodeficiency Diseases	Associate	37683642

IRF4 (interferon regulatory factor 4)