Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3660
Gene name Gene Name - the full gene name approved by the HGNC.	Interferon regulatory factor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IRF2
Synonyms (NCBI Gene) Gene synonyms aliases	IRF-2
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q35.1
Summary Summary of gene provided in NCBI Entrez Gene.	IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that e

Show/Hide all(235)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT006178	hsa-miR-20a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR, Western blot	21880628
MIRT017202	hsa-miR-335-5p	Microarray	18185580
MIRT047780	hsa-miR-30d-5p	CLASH	23622248
MIRT536623	hsa-miR-18b-5p	PAR-CLIP	22012620
MIRT536622	hsa-miR-4735-3p	PAR-CLIP	22012620
MIRT536621	hsa-miR-18a-5p	PAR-CLIP	22012620
MIRT536610	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536620	hsa-miR-520f-3p	PAR-CLIP	22012620
MIRT536619	hsa-miR-520b	PAR-CLIP	22012620
MIRT536618	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536617	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536616	hsa-miR-520e	PAR-CLIP	22012620
MIRT536615	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536614	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536613	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536612	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536611	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536610	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536609	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536608	hsa-miR-302e	PAR-CLIP	22012620
MIRT536607	hsa-miR-4662a-3p	PAR-CLIP	22012620
MIRT536606	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT536605	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT536604	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT536603	hsa-miR-3607-3p	PAR-CLIP	22012620
MIRT536602	hsa-miR-298	PAR-CLIP	22012620
MIRT536600	hsa-miR-3686	PAR-CLIP	22012620
MIRT536601	hsa-miR-3658	PAR-CLIP	22012620
MIRT503946	hsa-miR-1276	PAR-CLIP	22012620
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	22012620
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	22012620
MIRT503946	hsa-miR-1276	PAR-CLIP	23446348
MIRT503945	hsa-miR-5191	PAR-CLIP	23446348
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT503946	hsa-miR-1276	PAR-CLIP	23446348
MIRT503945	hsa-miR-5191	PAR-CLIP	23446348
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT536621	hsa-miR-18a-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26173586
MIRT536621	hsa-miR-18a-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	26173586
MIRT536618	hsa-miR-520c-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28203525
MIRT536618	hsa-miR-520c-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	28203525
MIRT733498	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31934069
MIRT733498	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blotting	31934069
MIRT737538	hsa-miR-204-3p	Luciferase reporter assay, Western blotting, ELISA	31934069
MIRT536623	hsa-miR-18b-5p	PAR-CLIP	22012620
MIRT536622	hsa-miR-4735-3p	PAR-CLIP	22012620
MIRT536621	hsa-miR-18a-5p	PAR-CLIP	22012620
MIRT536610	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536620	hsa-miR-520f-3p	PAR-CLIP	22012620
MIRT536619	hsa-miR-520b	PAR-CLIP	22012620
MIRT536618	hsa-miR-520c-3p	PAR-CLIP	22012620
MIRT536617	hsa-miR-520d-3p	PAR-CLIP	22012620
MIRT536616	hsa-miR-520e	PAR-CLIP	22012620
MIRT536615	hsa-miR-520a-3p	PAR-CLIP	22012620
MIRT536614	hsa-miR-373-3p	PAR-CLIP	22012620
MIRT536613	hsa-miR-302a-3p	PAR-CLIP	22012620
MIRT536612	hsa-miR-372-3p	PAR-CLIP	22012620
MIRT536611	hsa-miR-302b-3p	PAR-CLIP	22012620
MIRT536610	hsa-miR-302c-3p	PAR-CLIP	22012620
MIRT536609	hsa-miR-302d-3p	PAR-CLIP	22012620
MIRT536608	hsa-miR-302e	PAR-CLIP	22012620
MIRT536607	hsa-miR-4662a-3p	PAR-CLIP	22012620
MIRT536606	hsa-miR-519a-3p	PAR-CLIP	22012620
MIRT536605	hsa-miR-519b-3p	PAR-CLIP	22012620
MIRT536604	hsa-miR-519c-3p	PAR-CLIP	22012620
MIRT536603	hsa-miR-3607-3p	PAR-CLIP	22012620
MIRT536602	hsa-miR-298	PAR-CLIP	22012620
MIRT536600	hsa-miR-3686	PAR-CLIP	22012620
MIRT536601	hsa-miR-3658	PAR-CLIP	22012620
MIRT503946	hsa-miR-1276	PAR-CLIP	22012620
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	22012620
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	22012620
MIRT503946	hsa-miR-1276	PAR-CLIP	23446348
MIRT503945	hsa-miR-5191	PAR-CLIP	23446348
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT503946	hsa-miR-1276	PAR-CLIP	23446348
MIRT503945	hsa-miR-5191	PAR-CLIP	23446348
MIRT503943	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT503944	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT755962	gga-miR-455-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35806321
MIRT756288	hsa-miR-222-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37621743
MIRT1070875	hsa-miR-1	CLIP-seq
MIRT1070876	hsa-miR-1200	CLIP-seq
MIRT1070877	hsa-miR-1227	CLIP-seq
MIRT1070878	hsa-miR-1237	CLIP-seq
MIRT1070879	hsa-miR-1248	CLIP-seq
MIRT1070880	hsa-miR-1256	CLIP-seq
MIRT1070881	hsa-miR-1265	CLIP-seq
MIRT1070882	hsa-miR-1289	CLIP-seq
MIRT1070883	hsa-miR-1290	CLIP-seq
MIRT1070884	hsa-miR-1302	CLIP-seq
MIRT1070885	hsa-miR-2054	CLIP-seq
MIRT1070886	hsa-miR-206	CLIP-seq
MIRT1070887	hsa-miR-2110	CLIP-seq
MIRT1070888	hsa-miR-2278	CLIP-seq
MIRT1070889	hsa-miR-3064-3p	CLIP-seq
MIRT1070890	hsa-miR-3065-5p	CLIP-seq
MIRT1070891	hsa-miR-3120-3p	CLIP-seq
MIRT1070892	hsa-miR-3121-5p	CLIP-seq
MIRT1070893	hsa-miR-3123	CLIP-seq
MIRT1070894	hsa-miR-3137	CLIP-seq
MIRT1070895	hsa-miR-3154	CLIP-seq
MIRT1070896	hsa-miR-3179	CLIP-seq
MIRT1070897	hsa-miR-3190	CLIP-seq
MIRT1070898	hsa-miR-3198	CLIP-seq
MIRT1070899	hsa-miR-342-5p	CLIP-seq
MIRT1070900	hsa-miR-3647-3p	CLIP-seq
MIRT1070901	hsa-miR-3659	CLIP-seq
MIRT1070902	hsa-miR-3673	CLIP-seq
MIRT1070903	hsa-miR-380	CLIP-seq
MIRT1070904	hsa-miR-3919	CLIP-seq
MIRT1070905	hsa-miR-3925-5p	CLIP-seq
MIRT1070906	hsa-miR-4271	CLIP-seq
MIRT1070907	hsa-miR-4274	CLIP-seq
MIRT1070908	hsa-miR-4279	CLIP-seq
MIRT1070909	hsa-miR-4294	CLIP-seq
MIRT1070910	hsa-miR-4298	CLIP-seq
MIRT1070911	hsa-miR-4309	CLIP-seq
MIRT1070912	hsa-miR-4311	CLIP-seq
MIRT1070913	hsa-miR-4324	CLIP-seq
MIRT1070914	hsa-miR-4422	CLIP-seq
MIRT1070915	hsa-miR-4424	CLIP-seq
MIRT1070916	hsa-miR-4457	CLIP-seq
MIRT1070917	hsa-miR-4473	CLIP-seq
MIRT1070918	hsa-miR-4476	CLIP-seq
MIRT1070919	hsa-miR-4491	CLIP-seq
MIRT1070920	hsa-miR-4505	CLIP-seq
MIRT1070921	hsa-miR-451b	CLIP-seq
MIRT1070922	hsa-miR-4520a-3p	CLIP-seq
MIRT1070923	hsa-miR-4520b-3p	CLIP-seq
MIRT1070924	hsa-miR-455-5p	CLIP-seq
MIRT1070925	hsa-miR-4657	CLIP-seq
MIRT1070926	hsa-miR-4658	CLIP-seq
MIRT1070927	hsa-miR-4659a-3p	CLIP-seq
MIRT1070928	hsa-miR-4659b-3p	CLIP-seq
MIRT1070929	hsa-miR-4663	CLIP-seq
MIRT1070930	hsa-miR-4664-5p	CLIP-seq
MIRT1070931	hsa-miR-4667-5p	CLIP-seq
MIRT1070932	hsa-miR-4677-3p	CLIP-seq
MIRT1070933	hsa-miR-4682	CLIP-seq
MIRT1070934	hsa-miR-4700-5p	CLIP-seq
MIRT1070935	hsa-miR-4725-3p	CLIP-seq
MIRT1070936	hsa-miR-4731-5p	CLIP-seq
MIRT1070937	hsa-miR-4732-5p	CLIP-seq
MIRT1070938	hsa-miR-4760-3p	CLIP-seq
MIRT1070939	hsa-miR-4764-5p	CLIP-seq
MIRT1070940	hsa-miR-4766-5p	CLIP-seq
MIRT1070941	hsa-miR-4778-3p	CLIP-seq
MIRT1070942	hsa-miR-485-5p	CLIP-seq
MIRT1070943	hsa-miR-498	CLIP-seq
MIRT1070944	hsa-miR-512-3p	CLIP-seq
MIRT1070945	hsa-miR-513b	CLIP-seq
MIRT1070946	hsa-miR-520f	CLIP-seq
MIRT1070947	hsa-miR-539	CLIP-seq
MIRT1070948	hsa-miR-544b	CLIP-seq
MIRT1070949	hsa-miR-574-5p	CLIP-seq
MIRT1070950	hsa-miR-579	CLIP-seq
MIRT1070951	hsa-miR-583	CLIP-seq
MIRT1070952	hsa-miR-613	CLIP-seq
MIRT1070953	hsa-miR-622	CLIP-seq
MIRT1070954	hsa-miR-648	CLIP-seq
MIRT1070955	hsa-miR-664	CLIP-seq
MIRT1070956	hsa-miR-671-5p	CLIP-seq
MIRT1070957	hsa-miR-942	CLIP-seq
MIRT1070891	hsa-miR-3120-3p	CLIP-seq
MIRT1070922	hsa-miR-4520a-3p	CLIP-seq
MIRT1070923	hsa-miR-4520b-3p	CLIP-seq
MIRT1070891	hsa-miR-3120-3p	CLIP-seq
MIRT1070916	hsa-miR-4457	CLIP-seq
MIRT1070922	hsa-miR-4520a-3p	CLIP-seq
MIRT1070923	hsa-miR-4520b-3p	CLIP-seq
MIRT1070880	hsa-miR-1256	CLIP-seq
MIRT1070883	hsa-miR-1290	CLIP-seq
MIRT2249351	hsa-miR-129-3p	CLIP-seq
MIRT2249352	hsa-miR-214	CLIP-seq
MIRT1070891	hsa-miR-3120-3p	CLIP-seq
MIRT1070892	hsa-miR-3121-5p	CLIP-seq
MIRT1070895	hsa-miR-3154	CLIP-seq
MIRT2249353	hsa-miR-3155	CLIP-seq
MIRT2249354	hsa-miR-3155b	CLIP-seq
MIRT2249355	hsa-miR-3192	CLIP-seq
MIRT2249356	hsa-miR-338-3p	CLIP-seq
MIRT2249357	hsa-miR-3619-5p	CLIP-seq
MIRT1070900	hsa-miR-3647-3p	CLIP-seq
MIRT1070907	hsa-miR-4274	CLIP-seq
MIRT2249358	hsa-miR-4292	CLIP-seq
MIRT1070914	hsa-miR-4422	CLIP-seq
MIRT1070922	hsa-miR-4520a-3p	CLIP-seq
MIRT1070923	hsa-miR-4520b-3p	CLIP-seq
MIRT2249359	hsa-miR-4530	CLIP-seq
MIRT2249360	hsa-miR-4683	CLIP-seq
MIRT2249361	hsa-miR-4687-5p	CLIP-seq
MIRT2249362	hsa-miR-4690-5p	CLIP-seq
MIRT1070940	hsa-miR-4766-5p	CLIP-seq
MIRT2249363	hsa-miR-484	CLIP-seq
MIRT1070943	hsa-miR-498	CLIP-seq
MIRT1070946	hsa-miR-520f	CLIP-seq
MIRT1070953	hsa-miR-622	CLIP-seq
MIRT2249364	hsa-miR-761	CLIP-seq
MIRT1070883	hsa-miR-1290	CLIP-seq
MIRT2430078	hsa-miR-1827	CLIP-seq
MIRT2430079	hsa-miR-23a	CLIP-seq
MIRT2430080	hsa-miR-23b	CLIP-seq
MIRT2430081	hsa-miR-23c	CLIP-seq
MIRT2430082	hsa-miR-3176	CLIP-seq
MIRT2430083	hsa-miR-3200-3p	CLIP-seq
MIRT2430084	hsa-miR-3922-3p	CLIP-seq
MIRT2430085	hsa-miR-4267	CLIP-seq
MIRT2430086	hsa-miR-4303	CLIP-seq
MIRT2430087	hsa-miR-4649-3p	CLIP-seq
MIRT1070881	hsa-miR-1265	CLIP-seq
MIRT1070885	hsa-miR-2054	CLIP-seq
MIRT1070889	hsa-miR-3064-3p	CLIP-seq
MIRT2552935	hsa-miR-340	CLIP-seq
MIRT1070903	hsa-miR-380	CLIP-seq
MIRT2552936	hsa-miR-4282	CLIP-seq
MIRT1070916	hsa-miR-4457	CLIP-seq
MIRT2552937	hsa-miR-4718	CLIP-seq
MIRT2552938	hsa-miR-513a-3p	CLIP-seq
MIRT2552939	hsa-miR-577	CLIP-seq
MIRT2682911	hsa-miR-4323	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
CIITA	Unknown	15950283
IRF1	Activation	9054665
PITX1	Repression	12242290

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	7507207
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IMP	9540062
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	9540062
GO:0002376	Process	Immune system process	IBA	21873635
GO:0003677	Function	DNA binding	IDA	9540062
GO:0003700	Function	DNA-binding transcription factor activity	IMP	9540062
GO:0005515	Function	Protein binding	IPI	9540062, 21903422, 25609649, 28514442
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	IDA
GO:0006355	Process	Regulation of transcription, DNA-templated	IMP	9540062
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0007596	Process	Blood coagulation	TAS
GO:0008283	Process	Cell population proliferation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	9540062
GO:0051607	Process	Defense response to virus	IDA	21478870
GO:0060333	Process	Interferon-gamma-mediated signaling pathway	TAS
GO:0060337	Process	Type I interferon signaling pathway	TAS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
147576	6117	ENSG00000168310

Protein

UniProt ID

P14316

Protein name

Interferon regulatory factor 2 (IRF-2)

Protein function

Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constit

PDB

8YTG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00605	IRF	7 → 112	Interferon regulatory factor transcription factor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed throughout the epithelium of the colon. Also expressed in lamina propria. {ECO:0000269|PubMed:15226432}.

Sequence

MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSK
KGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQ
SHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVP
SDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVP
YNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC

Sequence length

349

Interactions

View interactions

	Reactome
			Interferon gamma signaling Interferon alpha/beta signaling Factors involved in megakaryocyte development and platelet production

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Alzheimer`s Disease	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	29274321

Show/Hide Text Mining Associations (54)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Kidney Injury	Associate	27576016
Breast Neoplasms	Associate	11323500, 14651776, 16241857, 35441810, 37584152
Burkitt Lymphoma	Associate	9261415
Carcinogenesis	Associate	22119988
Carcinoid Tumor	Associate	10942060
Carcinoma Ductal	Stimulate	11323500
Carcinoma Hepatocellular	Associate	22561517, 25021421, 32671843
Carcinoma Intraductal Noninfiltrating	Associate	11323500
Carcinoma Non Small Cell Lung	Associate	34022918
Cell Transformation Viral	Associate	11559933
Colonic Neoplasms	Associate	33161410
Colorectal Neoplasms	Associate	21859832, 25541970, 28465494, 30991021, 33787608
Coronary Artery Disease	Associate	26936111
COVID 19	Associate	34312772, 35718334
Cytokine Release Syndrome	Associate	17200120
Dermatitis Atopic	Associate	22113474
Endometrial Neoplasms	Associate	35993041
Enterocolitis Necrotizing	Stimulate	33880370
Esophageal Neoplasms	Associate	28467773
Familial Primary Pulmonary Hypertension	Associate	36899621
Gardner Syndrome	Associate	33787608
Glioma	Stimulate	33902005
Hereditary Breast and Ovarian Cancer Syndrome	Associate	11323500
Inflammation	Associate	33880370
Inflammatory Bowel Diseases	Associate	35212366
Kaposi Varicelliform Eruption	Associate	22113474
Kidney Diseases	Associate	34952945
Leukemia Lymphocytic Chronic B Cell	Associate	27611921
Leukemia Myeloid Acute	Associate	11559933, 21880628, 30876449, 37621743
Lupus Erythematosus Systemic	Associate	25285625
Lymphatic Metastasis	Stimulate	22119988
Lymphoma B Cell Marginal Zone	Associate	34952945
Lymphoma Large B Cell Diffuse	Associate	23487038
Lymphoma Primary Effusion	Associate	31666375
Melanoma	Associate	18511292
Melanoma Cutaneous Malignant	Associate	32902917, 36341357
Muscular Dystrophy Facioscapulohumeral	Associate	19888305
Neoplasm Metastasis	Stimulate	28465494
Neoplasms	Associate	16241857, 26460486, 28465494, 28467773, 28494239, 31395065, 34593621
Neoplasms	Inhibit	17200120, 21197417, 22561517, 31471524
Neoplasms	Stimulate	33902005, 35012444
Neurodegenerative Diseases	Stimulate	34312772
Osteoporosis	Associate	28344004, 34743649
Ovarian Neoplasms	Associate	27806724
Pancreatic Neoplasms	Associate	22119988
Pancreatic Neoplasms	Stimulate	35012444
Post Acute COVID 19 Syndrome	Associate	37580654
Prostatitis	Inhibit	31471524
Psoriasis	Associate	36833372
Rectal Neoplasms	Associate	25541970
Respiratory Distress Syndrome	Associate	34418997
Stomach Neoplasms	Associate	20507321
Virus Diseases	Associate	22113474
Warts	Associate	31892232

IRF2 (interferon regulatory factor 2)