Gene Gene information from NCBI Gene database.
Entrez ID 3660
Gene name Interferon regulatory factor 2
Gene symbol IRF2
Synonyms (NCBI Gene)
IRF-2
Chromosome 4
Chromosome location 4q35.1
Summary IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that e
miRNA miRNA information provided by mirtarbase database.
235
miRTarBase ID miRNA Experiments Reference
MIRT006178 hsa-miR-20a-5p Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot 21880628
MIRT006178 hsa-miR-20a-5p Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot 21880628
MIRT006178 hsa-miR-20a-5p Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot 21880628
MIRT006178 hsa-miR-20a-5p Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot 21880628
MIRT006178 hsa-miR-20a-5p Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot 21880628
Transcription factors Transcription factors information provided by TRRUST V2 database.
3
Transcription factor Regulation Reference
CIITA Unknown 15950283
IRF1 Activation 9054665
PITX1 Repression 12242290
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
31
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II TAS 7507207
GO:0000785 Component Chromatin ISA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IMP 9540062
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
147576 6117 ENSG00000168310
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P14316
Protein name Interferon regulatory factor 2 (IRF-2)
Protein function Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constit
PDB 8YTG
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00605 IRF 7 112 Interferon regulatory factor transcription factor Domain
Tissue specificity TISSUE SPECIFICITY: Expressed throughout the epithelium of the colon. Also expressed in lamina propria. {ECO:0000269|PubMed:15226432}.
Sequence
MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAI
HTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRML
PLSERPSK
KGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQ
SHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVP
SDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVP
YNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC
Sequence length 349
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Interferon gamma signaling
Interferon alpha/beta signaling
Factors involved in megakaryocyte development and platelet production