Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3656
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 1 receptor associated kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IRAK2
Synonyms (NCBI Gene) Gene synonyms aliases
IRAK-2
Chromosome Chromosome number
3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
3p25.3
Summary Summary of gene provided in NCBI Entrez Gene.
IRAK2 encodes the interleukin-1 receptor-associated kinase 2, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. IRAK2 is reported to participate in the IL1-induced upregulation of
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT000304 hsa-miR-146a-5p qRT-PCR, Western blot 20124483
MIRT017238 hsa-miR-335-5p Microarray 18185580
MIRT000304 hsa-miR-146a-5p qRT-PCR, Western blot 25889446
MIRT000304 hsa-miR-146a-5p qRT-PCR 28077577
MIRT732913 hsa-miR-497-3p Immunofluorescence, Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting 32706167
Transcription factors
Transcription factor Regulation Reference
CTCF Unknown 15670593
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000187 Process Activation of MAPK activity TAS
GO:0001959 Process Regulation of cytokine-mediated signaling pathway IMP 10383454
GO:0002224 Process Toll-like receptor signaling pathway TAS
GO:0002755 Process MyD88-dependent toll-like receptor signaling pathway TAS 10383454
GO:0004672 Function Protein kinase activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603304 6113 ENSG00000134070
Protein
UniProt ID O43187
Protein name Interleukin-1 receptor-associated kinase-like 2 (IRAK-2)
Protein function Binds to the IL-1 type I receptor following IL-1 engagement, triggering intracellular signaling cascades leading to transcriptional up-regulation and mRNA stabilization.
PDB 3MOP
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00531 Death 13 94 Death domain Domain
PF00069 Pkinase 210 461 Protein kinase domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in spleen, thymus, prostate, lung, liver, skeletal muscle, kidney, pancreas and peripheral blood leukocytes. {ECO:0000269|PubMed:9374458}.
Sequence
MACYIYQLPSWVLDDLCRNMDALSEWDWMEFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWGMRQATVQQLVDLLCRLELYRAAQIILNWK
PAPEIRCPIPAFPDSVKPEKPLAASV
RKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFST
SIPKQEKLLSLAGDSLFWSEADVVQATDDFNQNRKISQGTFADVYRGHRHGKPFVFKKLR
ETACSSPGSIERFFQAELQICLRCCHPNVLPVLGFCAARQFHSFIYPYMANGSLQDRLQG
QGGSDPLPWPQRVSICSGLLCAVEYLHGLEIIHSNVKSSNVLLDQNLTPKLAHPMAHLCP
VNKRSKYTMMKTHLLRTSAAYLPEDFIRVGQLTKRVDIFSCGIVLAEVLTGIPAMDNNRS
PVYLKDLLLSDIPSSTASLCSRKTGVENVMAKEICQKYLEK
GAGRLPEDCAEALATAACL
CLRRRNTSLQEVCGSVAAVEERLRGRETLLPWSGLSEGTGSSSNTPEETDDVDNSSLDAS
SSMSVAPWAGAATPLLPTENGEGRLRVIVGREADSSSEACVGLEPPQDVTETSWQIEINE
AKRKLMENILLYKEEKVDSIELFGP
Sequence length 625
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Neurotrophin signaling pathway
Tuberculosis
  MyD88:MAL(TIRAP) cascade initiated on plasma membrane
NOD1/2 Signaling Pathway
TAK1 activates NFkB by phosphorylation and activation of IKKs complex
activated TAK1 mediates p38 MAPK activation
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
Interleukin-1 signaling
IRAK2 mediated activation of TAK1 complex
TRAF6-mediated induction of TAK1 complex within TLR4 complex
TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation
MyD88 dependent cascade initiated on endosome
IRAK2 mediated activation of TAK1 complex upon TLR7/8 or 9 stimulation
MyD88 cascade initiated on plasma membrane
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Lung adenocarcinoma Adenocarcinoma of lung (disorder) rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370
View all (5 more)
Unknown
Disease term Disease name Evidence References Source
Alzheimer disease Alzheimer disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 25063738
Alzheimer Disease Associate 20937840
Arthritis Rheumatoid Associate 35588430, 39342401
Asthma Stimulate 28223794
Bone Diseases Associate 37108068
Candidemia Associate 39299377
Carcinoma Non Small Cell Lung Associate 25063738, 29978465
Colonic Neoplasms Associate 26133168
Communicable Diseases Associate 39299377
Coronary Artery Disease Associate 23188791