Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3654
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 1 receptor associated kinase 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IRAK1
Synonyms (NCBI Gene) Gene synonyms aliases	IRAK, pelle
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq28
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes the interleukin-1 receptor-associated kinase 1, one of two putative serine/threonine kinases that become associated with the interleukin-1 receptor (IL1R) upon stimulation. This gene is partially responsible for IL1-induced upregulation

Show/Hide all(349)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000712	hsa-miR-146a-5p	Western blot, Northern blot	18504431
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Western blot	20061417
MIRT000712	hsa-miR-146a-5p	qRT-PCR	18759964
MIRT000712	hsa-miR-146a-5p	qRT-PCR, Western blot, Immunofluorescence	19918258
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Microarray, Northern blot, qRT-PCR	16885212
MIRT000712	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	20542134
MIRT000712	hsa-miR-146a-5p	ELISA, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	20542134
MIRT000712	hsa-miR-146a-5p	qRT-PCR, Western blot	21178010
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Western blot	21632853
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Western blot	21632853
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Western blot	21632853
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	22593544
MIRT000712	hsa-miR-146a-5p	Western blot	20110513
MIRT024479	hsa-miR-215-5p	Microarray	19074876
MIRT026216	hsa-miR-192-5p	Microarray	19074876
MIRT051021	hsa-miR-17-5p	CLASH	23622248
MIRT049357	hsa-miR-92a-3p	CLASH	23622248
MIRT046662	hsa-miR-222-3p	CLASH	23622248
MIRT045847	hsa-miR-132-3p	CLASH	23622248
MIRT043810	hsa-miR-328-3p	CLASH	23622248
MIRT042485	hsa-miR-423-3p	CLASH	23622248
MIRT041223	hsa-miR-193b-3p	CLASH	23622248
MIRT038891	hsa-miR-93-3p	CLASH	23622248
MIRT038255	hsa-miR-330-5p	CLASH	23622248
MIRT037612	hsa-miR-744-5p	CLASH	23622248
MIRT036505	hsa-miR-1226-3p	CLASH	23622248
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assay, qRT-PCR, Western blot	23680172
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23680172
MIRT000712	hsa-miR-146a-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22992343
MIRT000712	hsa-miR-146a-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	22992343
MIRT000712	hsa-miR-146a-5p	qRT-PCR, Western blot	23018031
MIRT054357	hsa-miR-21-5p	Chip, ELISA, Flow cytometry, Luciferase reporter assay, QRTPCR, Western blot	23633945
MIRT000712	hsa-miR-146a-5p	QRTPCR, Western blot	24867582
MIRT000712	hsa-miR-146a-5p	Microarray, Western blot	23952003
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	24107356
MIRT000712	hsa-miR-146a-5p	Microarray, Western blot	23952003
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	24107356
MIRT440429	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT440429	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	25623956
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26151128
MIRT000712	hsa-miR-146a-5p	ELISA, Immunohistochemistry, qRT-PCR, Western blot	27636999
MIRT000712	hsa-miR-146a-5p	qRT-PCR, Western blot	25889446
MIRT000712	hsa-miR-146a-5p	ELISA, EMSA, Microarray, qRT-PCR, Western blot	27922090
MIRT734683	hsa-miR-146b-3p	Luciferase reporter assay	25771167
MIRT000712	hsa-miR-146a-5p	qRT-PCR, Western blot	25805648
MIRT005395	hsa-miR-146b-5p	Luciferase reporter assay, qRT-PCR, Western blot	27533309
MIRT000712	hsa-miR-146a-5p	ChIP-seq, ELISA, qRT-PCR	34203452
MIRT000712	hsa-miR-146a-5p	Immunofluorescence, qRT-PCR	32210951
MIRT733241	hsa-miR-146a-3p	Immunocytochemistry (ICC), Mass spectrometry, qRT-PCR, Western blotting	33968923
MIRT733241	hsa-miR-146a-3p	ELISA, qRT-PCR	33430976
MIRT734331	hsa-miR-143-3p	ELISA, qRT-PCR	33430976
MIRT734681	hsa-miR-21-3p	Microarray, ELISA	31727077
MIRT733241	hsa-miR-146a-3p	Microarray, ELISA	31727077
MIRT734683	hsa-miR-146b-3p	Microarray, ELISA	31727077
MIRT735163	hsa-miR-192-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	32668391
MIRT000712	hsa-miR-146a-5p	qRT-PCR	31739406
MIRT733241	hsa-miR-146a-3p	Western blotting, qRT-PCR, Flow cytometry, ELISA	32117283
MIRT736424	hsa-miR-491-3p	qRT-PCR, Flow cytometry	33679688
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	32935891
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Immunofluorescence	37391426
MIRT000712	hsa-miR-146a-5p	qRT-PCR, Flow cytometry	35799283
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35777802
MIRT000712	hsa-miR-146a-5p	Luciferase reporter assay	36175984
MIRT1070321	hsa-miR-1207-3p	CLIP-seq
MIRT1070322	hsa-miR-1208	CLIP-seq
MIRT1070323	hsa-miR-134	CLIP-seq
MIRT1070324	hsa-miR-140-3p	CLIP-seq
MIRT1070325	hsa-miR-1587	CLIP-seq
MIRT1070326	hsa-miR-1914	CLIP-seq
MIRT1070327	hsa-miR-221	CLIP-seq
MIRT1070328	hsa-miR-222	CLIP-seq
MIRT1070329	hsa-miR-2355-5p	CLIP-seq
MIRT1070330	hsa-miR-3118	CLIP-seq
MIRT1070331	hsa-miR-3157-5p	CLIP-seq
MIRT1070332	hsa-miR-3164	CLIP-seq
MIRT1070333	hsa-miR-34b	CLIP-seq
MIRT1070334	hsa-miR-3607-5p	CLIP-seq
MIRT1070335	hsa-miR-3611	CLIP-seq
MIRT1070336	hsa-miR-3617	CLIP-seq
MIRT1070337	hsa-miR-3646	CLIP-seq
MIRT1070338	hsa-miR-3649	CLIP-seq
MIRT1070339	hsa-miR-3689a-5p	CLIP-seq
MIRT1070340	hsa-miR-3689b	CLIP-seq
MIRT1070341	hsa-miR-3689e	CLIP-seq
MIRT1070342	hsa-miR-3689f	CLIP-seq
MIRT1070343	hsa-miR-3690	CLIP-seq
MIRT1070344	hsa-miR-378g	CLIP-seq
MIRT1070345	hsa-miR-3977	CLIP-seq
MIRT1070346	hsa-miR-4253	CLIP-seq
MIRT1070347	hsa-miR-4492	CLIP-seq
MIRT1070348	hsa-miR-4498	CLIP-seq
MIRT1070349	hsa-miR-4530	CLIP-seq
MIRT1070350	hsa-miR-4656	CLIP-seq
MIRT1070351	hsa-miR-4666-5p	CLIP-seq
MIRT1070352	hsa-miR-4675	CLIP-seq
MIRT1070353	hsa-miR-4741	CLIP-seq
MIRT1070354	hsa-miR-4786-3p	CLIP-seq
MIRT1070355	hsa-miR-4798-3p	CLIP-seq
MIRT1070356	hsa-miR-490-3p	CLIP-seq
MIRT1070357	hsa-miR-511	CLIP-seq
MIRT1070358	hsa-miR-548v	CLIP-seq
MIRT1070359	hsa-miR-556-3p	CLIP-seq
MIRT1070360	hsa-miR-558	CLIP-seq
MIRT1070361	hsa-miR-619	CLIP-seq
MIRT1070362	hsa-miR-641	CLIP-seq
MIRT1070363	hsa-miR-646	CLIP-seq
MIRT1070364	hsa-miR-648	CLIP-seq
MIRT1070365	hsa-miR-661	CLIP-seq
MIRT1070366	hsa-miR-762	CLIP-seq
MIRT1070367	hsa-miR-888	CLIP-seq
MIRT1070368	hsa-miR-106a	CLIP-seq
MIRT1070369	hsa-miR-106b	CLIP-seq
MIRT1070370	hsa-miR-1182	CLIP-seq
MIRT1070322	hsa-miR-1208	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT1070372	hsa-miR-1229	CLIP-seq
MIRT1070373	hsa-miR-1231	CLIP-seq
MIRT1070374	hsa-miR-150	CLIP-seq
MIRT1070375	hsa-miR-17	CLIP-seq
MIRT1070376	hsa-miR-1915	CLIP-seq
MIRT1070377	hsa-miR-193a-5p	CLIP-seq
MIRT1070378	hsa-miR-1976	CLIP-seq
MIRT1070379	hsa-miR-20a	CLIP-seq
MIRT1070380	hsa-miR-20b	CLIP-seq
MIRT1070381	hsa-miR-302a	CLIP-seq
MIRT1070382	hsa-miR-302b	CLIP-seq
MIRT1070383	hsa-miR-302c	CLIP-seq
MIRT1070384	hsa-miR-302d	CLIP-seq
MIRT1070385	hsa-miR-302e	CLIP-seq
MIRT1070386	hsa-miR-3120-5p	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT1070388	hsa-miR-3194-3p	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT1070390	hsa-miR-3672	CLIP-seq
MIRT1070391	hsa-miR-372	CLIP-seq
MIRT1070392	hsa-miR-373	CLIP-seq
MIRT1070393	hsa-miR-431	CLIP-seq
MIRT1070394	hsa-miR-4312	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT1070396	hsa-miR-4438	CLIP-seq
MIRT1070397	hsa-miR-4446-5p	CLIP-seq
MIRT1070398	hsa-miR-4666-3p	CLIP-seq
MIRT1070399	hsa-miR-4685-5p	CLIP-seq
MIRT1070400	hsa-miR-4722-3p	CLIP-seq
MIRT1070401	hsa-miR-4726-3p	CLIP-seq
MIRT1070402	hsa-miR-4731-5p	CLIP-seq
MIRT1070403	hsa-miR-4757-5p	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT1070405	hsa-miR-494	CLIP-seq
MIRT1070406	hsa-miR-5095	CLIP-seq
MIRT1070407	hsa-miR-512-3p	CLIP-seq
MIRT1070408	hsa-miR-519d	CLIP-seq
MIRT1070409	hsa-miR-520a-3p	CLIP-seq
MIRT1070410	hsa-miR-520b	CLIP-seq
MIRT1070411	hsa-miR-520c-3p	CLIP-seq
MIRT1070412	hsa-miR-520d-3p	CLIP-seq
MIRT1070413	hsa-miR-520e	CLIP-seq
MIRT1070414	hsa-miR-520g	CLIP-seq
MIRT1070415	hsa-miR-520h	CLIP-seq
MIRT1070416	hsa-miR-555	CLIP-seq
MIRT1070417	hsa-miR-600	CLIP-seq
MIRT1070418	hsa-miR-93	CLIP-seq
MIRT2017311	hsa-miR-1197	CLIP-seq
MIRT1070334	hsa-miR-3607-5p	CLIP-seq
MIRT1070336	hsa-miR-3617	CLIP-seq
MIRT1070339	hsa-miR-3689a-5p	CLIP-seq
MIRT1070340	hsa-miR-3689b	CLIP-seq
MIRT1070341	hsa-miR-3689e	CLIP-seq
MIRT1070342	hsa-miR-3689f	CLIP-seq
MIRT1070351	hsa-miR-4666-5p	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT1070362	hsa-miR-641	CLIP-seq
MIRT2017312	hsa-miR-146a	CLIP-seq
MIRT1070339	hsa-miR-3689a-5p	CLIP-seq
MIRT1070340	hsa-miR-3689b	CLIP-seq
MIRT1070341	hsa-miR-3689e	CLIP-seq
MIRT1070342	hsa-miR-3689f	CLIP-seq
MIRT1070346	hsa-miR-4253	CLIP-seq
MIRT1070351	hsa-miR-4666-5p	CLIP-seq
MIRT2017313	hsa-miR-589	CLIP-seq
MIRT1070365	hsa-miR-661	CLIP-seq
MIRT2249209	hsa-miR-1184	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT1070374	hsa-miR-150	CLIP-seq
MIRT1070378	hsa-miR-1976	CLIP-seq
MIRT2249210	hsa-miR-3117-3p	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT2249211	hsa-miR-3169	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT2249212	hsa-miR-3680	CLIP-seq
MIRT1070346	hsa-miR-4253	CLIP-seq
MIRT1070394	hsa-miR-4312	CLIP-seq
MIRT2249213	hsa-miR-4418	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT1070398	hsa-miR-4666-3p	CLIP-seq
MIRT1070400	hsa-miR-4722-3p	CLIP-seq
MIRT2249214	hsa-miR-4724-5p	CLIP-seq
MIRT2249215	hsa-miR-4740-5p	CLIP-seq
MIRT1070403	hsa-miR-4757-5p	CLIP-seq
MIRT2249216	hsa-miR-4759	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT2249217	hsa-miR-509-3-5p	CLIP-seq
MIRT2249218	hsa-miR-509-5p	CLIP-seq
MIRT1070407	hsa-miR-512-3p	CLIP-seq
MIRT1070323	hsa-miR-134	CLIP-seq
MIRT2389465	hsa-miR-149	CLIP-seq
MIRT1070376	hsa-miR-1915	CLIP-seq
MIRT1070330	hsa-miR-3118	CLIP-seq
MIRT1070332	hsa-miR-3164	CLIP-seq
MIRT2389466	hsa-miR-3661	CLIP-seq
MIRT1070397	hsa-miR-4446-5p	CLIP-seq
MIRT1070401	hsa-miR-4726-3p	CLIP-seq
MIRT1070355	hsa-miR-4798-3p	CLIP-seq
MIRT2389467	hsa-miR-631	CLIP-seq
MIRT1070364	hsa-miR-648	CLIP-seq
MIRT1070370	hsa-miR-1182	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT1070377	hsa-miR-193a-5p	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT1070388	hsa-miR-3194-3p	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT1070393	hsa-miR-431	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT1070405	hsa-miR-494	CLIP-seq
MIRT1070370	hsa-miR-1182	CLIP-seq
MIRT2249209	hsa-miR-1184	CLIP-seq
MIRT1070321	hsa-miR-1207-3p	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT2552731	hsa-miR-1254	CLIP-seq
MIRT2552732	hsa-miR-1295	CLIP-seq
MIRT1070324	hsa-miR-140-3p	CLIP-seq
MIRT2552733	hsa-miR-148a	CLIP-seq
MIRT2552734	hsa-miR-148b	CLIP-seq
MIRT2389465	hsa-miR-149	CLIP-seq
MIRT1070374	hsa-miR-150	CLIP-seq
MIRT2552735	hsa-miR-152	CLIP-seq
MIRT1070376	hsa-miR-1915	CLIP-seq
MIRT1070377	hsa-miR-193a-5p	CLIP-seq
MIRT2552736	hsa-miR-1972	CLIP-seq
MIRT1070329	hsa-miR-2355-5p	CLIP-seq
MIRT2552737	hsa-miR-2467-5p	CLIP-seq
MIRT2552738	hsa-miR-2861	CLIP-seq
MIRT2552739	hsa-miR-3064-3p	CLIP-seq
MIRT2552740	hsa-miR-3116	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT1070331	hsa-miR-3157-5p	CLIP-seq
MIRT2552741	hsa-miR-3188	CLIP-seq
MIRT1070388	hsa-miR-3194-3p	CLIP-seq
MIRT1070337	hsa-miR-3646	CLIP-seq
MIRT1070338	hsa-miR-3649	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT2389466	hsa-miR-3661	CLIP-seq
MIRT2249212	hsa-miR-3680	CLIP-seq
MIRT2552742	hsa-miR-3929	CLIP-seq
MIRT2552743	hsa-miR-3975	CLIP-seq
MIRT2552744	hsa-miR-4267	CLIP-seq
MIRT2552745	hsa-miR-4293	CLIP-seq
MIRT1070393	hsa-miR-431	CLIP-seq
MIRT2552746	hsa-miR-4327	CLIP-seq
MIRT2249213	hsa-miR-4418	CLIP-seq
MIRT2552747	hsa-miR-4419b	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT2552748	hsa-miR-4474-3p	CLIP-seq
MIRT2552749	hsa-miR-4478	CLIP-seq
MIRT1070349	hsa-miR-4530	CLIP-seq
MIRT2552750	hsa-miR-4649-3p	CLIP-seq
MIRT2552751	hsa-miR-4663	CLIP-seq
MIRT1070398	hsa-miR-4666-3p	CLIP-seq
MIRT2552752	hsa-miR-4671-5p	CLIP-seq
MIRT2552753	hsa-miR-4717-5p	CLIP-seq
MIRT2552754	hsa-miR-4755-3p	CLIP-seq
MIRT1070403	hsa-miR-4757-5p	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT2552755	hsa-miR-485-5p	CLIP-seq
MIRT1070405	hsa-miR-494	CLIP-seq
MIRT2249217	hsa-miR-509-3-5p	CLIP-seq
MIRT2249218	hsa-miR-509-5p	CLIP-seq
MIRT2552756	hsa-miR-515-3p	CLIP-seq
MIRT2552757	hsa-miR-519e	CLIP-seq
MIRT2552758	hsa-miR-544b	CLIP-seq
MIRT2552759	hsa-miR-550a	CLIP-seq
MIRT2552760	hsa-miR-566	CLIP-seq
MIRT2389467	hsa-miR-631	CLIP-seq
MIRT1070363	hsa-miR-646	CLIP-seq
MIRT1070365	hsa-miR-661	CLIP-seq
MIRT2552761	hsa-miR-663b	CLIP-seq
MIRT1070370	hsa-miR-1182	CLIP-seq
MIRT2249209	hsa-miR-1184	CLIP-seq
MIRT1070371	hsa-miR-122	CLIP-seq
MIRT2552731	hsa-miR-1254	CLIP-seq
MIRT2552733	hsa-miR-148a	CLIP-seq
MIRT2552734	hsa-miR-148b	CLIP-seq
MIRT2389465	hsa-miR-149	CLIP-seq
MIRT1070374	hsa-miR-150	CLIP-seq
MIRT2552735	hsa-miR-152	CLIP-seq
MIRT1070376	hsa-miR-1915	CLIP-seq
MIRT1070377	hsa-miR-193a-5p	CLIP-seq
MIRT2552737	hsa-miR-2467-5p	CLIP-seq
MIRT2552738	hsa-miR-2861	CLIP-seq
MIRT2552739	hsa-miR-3064-3p	CLIP-seq
MIRT2552740	hsa-miR-3116	CLIP-seq
MIRT1070387	hsa-miR-3135b	CLIP-seq
MIRT1070331	hsa-miR-3157-5p	CLIP-seq
MIRT2552741	hsa-miR-3188	CLIP-seq
MIRT1070388	hsa-miR-3194-3p	CLIP-seq
MIRT1070337	hsa-miR-3646	CLIP-seq
MIRT1070389	hsa-miR-3652	CLIP-seq
MIRT2389466	hsa-miR-3661	CLIP-seq
MIRT2249212	hsa-miR-3680	CLIP-seq
MIRT2552742	hsa-miR-3929	CLIP-seq
MIRT2552743	hsa-miR-3975	CLIP-seq
MIRT2552745	hsa-miR-4293	CLIP-seq
MIRT1070393	hsa-miR-431	CLIP-seq
MIRT2552746	hsa-miR-4327	CLIP-seq
MIRT2249213	hsa-miR-4418	CLIP-seq
MIRT2552747	hsa-miR-4419b	CLIP-seq
MIRT1070395	hsa-miR-4430	CLIP-seq
MIRT2552748	hsa-miR-4474-3p	CLIP-seq
MIRT2552749	hsa-miR-4478	CLIP-seq
MIRT2552750	hsa-miR-4649-3p	CLIP-seq
MIRT2552751	hsa-miR-4663	CLIP-seq
MIRT1070398	hsa-miR-4666-3p	CLIP-seq
MIRT2552752	hsa-miR-4671-5p	CLIP-seq
MIRT1070403	hsa-miR-4757-5p	CLIP-seq
MIRT1070404	hsa-miR-485-3p	CLIP-seq
MIRT2552755	hsa-miR-485-5p	CLIP-seq
MIRT1070405	hsa-miR-494	CLIP-seq
MIRT2249217	hsa-miR-509-3-5p	CLIP-seq
MIRT2249218	hsa-miR-509-5p	CLIP-seq
MIRT2552756	hsa-miR-515-3p	CLIP-seq
MIRT2552757	hsa-miR-519e	CLIP-seq
MIRT2552758	hsa-miR-544b	CLIP-seq
MIRT2552759	hsa-miR-550a	CLIP-seq
MIRT2552760	hsa-miR-566	CLIP-seq
MIRT2389467	hsa-miR-631	CLIP-seq
MIRT1070365	hsa-miR-661	CLIP-seq
MIRT2552761	hsa-miR-663b	CLIP-seq

Show/Hide all(66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	TAS
GO:0001959	Process	Regulation of cytokine-mediated signaling pathway	IMP	10383454
GO:0002224	Process	Toll-like receptor signaling pathway	TAS
GO:0002755	Process	MyD88-dependent toll-like receptor signaling pathway	TAS	10383454
GO:0004672	Function	Protein kinase activity	IBA	21873635
GO:0004672	Function	Protein kinase activity	IDA	12054681
GO:0004672	Function	Protein kinase activity	TAS
GO:0004674	Function	Protein serine/threonine kinase activity	EXP	11960013
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0004704	Function	NF-kappaB-inducing kinase activity	TAS	8599092
GO:0005515	Function	Protein binding	IPI	10854325, 11397809, 11518704, 12242293, 12496252, 12860405, 12874243, 12925853, 16203735, 16884718, 17567694, 19081057, 19264966, 21743479, 21903422, 22037600, 28436939, 29883609
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005811	Component	Lipid droplet	ISS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0006468	Process	Protein phosphorylation	TAS	8599092
GO:0007250	Process	Activation of NF-kappaB-inducing kinase activity	IDA	11397809
GO:0007254	Process	JNK cascade	TAS
GO:0007568	Process	Aging	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0016032	Process	Viral process	IEA
GO:0016301	Function	Kinase activity	IDA	12054681
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031663	Process	Lipopolysaccharide-mediated signaling pathway	IMP	10383454
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	10383454
GO:0032481	Process	Positive regulation of type I interferon production	IMP	23633945
GO:0032496	Process	Response to lipopolysaccharide	IMP	10383454
GO:0032991	Component	Protein-containing complex	IDA	10854325
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IBA	21873635
GO:0034134	Process	Toll-like receptor 2 signaling pathway	IMP	10383454
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IBA	21873635
GO:0034162	Process	Toll-like receptor 9 signaling pathway	TAS
GO:0034605	Process	Cellular response to heat	IEA
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0042802	Function	Identical protein binding	IPI	11397809
GO:0042803	Function	Protein homodimerization activity	IPI	10383454
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	21873635
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	IMP	22158417
GO:0043123	Process	Positive regulation of I-kappaB kinase/NF-kappaB signaling	TAS
GO:0043406	Process	Positive regulation of MAP kinase activity	IBA	21873635
GO:0045087	Process	Innate immune response	IBA	21873635
GO:0046777	Process	Protein autophosphorylation	IDA	10383454, 12054681
GO:0046982	Function	Protein heterodimerization activity	IPI	10383454
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	10383454
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	TAS
GO:0060337	Process	Type I interferon signaling pathway	IMP	23633945
GO:0070423	Process	Nucleotide-binding oligomerization domain containing signaling pathway	TAS
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IBA	21873635
GO:0070498	Process	Interleukin-1-mediated signaling pathway	IMP	10383454
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0070555	Process	Response to interleukin-1	IMP	10383454
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA	21873635
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA
GO:1901224	Process	Positive regulation of NIK/NF-kappaB signaling	IMP	25515214
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	25515214

MIM	HGNC	e!Ensembl
300283	6112	ENSG00000184216

Protein

UniProt ID

P51617

Protein name

Interleukin-1 receptor-associated kinase 1 (IRAK-1) (EC 2.7.11.1)

Protein function

Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways. Is rapidly recruited by MYD88 to the receptor-signaling

PDB

6BFN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00531	Death	27 → 103	Death domain	Domain
PF00069	Pkinase	212 → 517	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 and isoform 2 are ubiquitously expressed in all tissues examined, with isoform 1 being more strongly expressed than isoform 2. {ECO:0000269|PubMed:11397809}.

Sequence

MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS

Sequence length

712

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway NF-kappa B signaling pathway Toll-like receptor signaling pathway Neurotrophin signaling pathway Alcoholic liver disease Pathogenic Escherichia coli infection Salmonella infection Pertussis Yersinia infection Leishmaniasis Chagas disease Toxoplasmosis Tuberculosis Hepatitis B Measles Herpes simplex virus 1 infection Epstein-Barr virus infection Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Lipid and atherosclerosis		PIP3 activates AKT signaling MyD88:MAL(TIRAP) cascade initiated on plasma membrane NOD1/2 Signaling Pathway p75NTR recruits signalling complexes NF-kB is activated and signals survival TAK1 activates NFkB by phosphorylation and activation of IKKs complex activated TAK1 mediates p38 MAPK activation JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1 PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Interleukin-1 signaling IRAK1 recruits IKK complex TRAF6 mediated IRF7 activation in TLR7/8 or 9 signaling TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation MyD88 dependent cascade initiated on endosome MyD88 cascade initiated on plasma membrane

Show/Hide Causal Diseases (8)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Coronary artery disease	Coronary Artery Disease	rs137852988, rs121918313, rs121918529, rs121918531, rs137852340, rs1555800701, rs1215189537	20524934
Glioblastoma	Glioblastoma Multiforme	rs121913500, rs886042842, rs1555138291, rs1558518449, rs1567176006, rs1558650888
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)
Nephrotic syndrome	Nephrotic Syndrome	rs876657369, rs121912601, rs121912602, rs876657370, rs121912603, rs121912604, rs121912605, rs121907900, rs121907901, rs28941778, rs587776576, rs28942089, rs587776577, rs28941777, rs121907910 View all (152 more)
Renal insufficiency	Renal Insufficiency	rs1596536873
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	23143596
Systemic lupus erythematosus	Systemic lupus erythematosus, Pediatric systemic lupus erythematosus	rs72556554, rs1575496354, rs1307379746, rs758750492, rs1575497576

Show/Hide Text Mining Associations (95)

Disease Name	Relationship Type	References
Associations from Text Mining
Aggressive Periodontitis	Associate	28883894
AIDS Associated Nephropathy	Associate	32276639
Alzheimer Disease	Associate	20937840, 23300433
Antiphospholipid Syndrome	Associate	22288586
Arthritis Psoriatic	Stimulate	19166933
Arthritis Psoriatic	Associate	20500689
Arthritis Rheumatoid	Associate	18759964, 23233309, 28271077, 29734142
Atherosclerosis	Associate	17382928
Autistic Disorder	Associate	28302064
Autoimmune Diseases	Associate	25550857
Bone Diseases	Associate	12619925
Brachydactyly Type D	Stimulate	28504607
Carcinogenesis	Associate	24302991, 37031183, 40028213
Carcinoma Hepatocellular	Associate	36421353
Carcinoma Non Small Cell Lung	Associate	20028769
Carcinoma Non Small Cell Lung	Stimulate	25550857
Carcinoma Pancreatic Ductal	Associate	15548371, 33380238
Carcinoma Renal Cell	Associate	36138026
Carcinoma Squamous Cell	Stimulate	20028769
Celiac Disease	Associate	26843707
Chorea	Associate	28302064
Chromosomal Instability	Associate	31515286
Chromosome Disorders	Associate	31515286
Chromosome Xq28 Duplication Syndrome	Associate	28302064
Cognition Disorders	Associate	37256770
Colitis Ulcerative	Stimulate	26462859
Colorectal Neoplasms	Associate	34576039
Crohn Disease	Associate	26462859
Death	Associate	28069966
Diabetes Mellitus Type 1	Associate	33572095
Diabetes Mellitus Type 2	Associate	20067962, 36552771
Ectrodactyly	Associate	37256770
Epilepsy	Associate	28302064
Esophageal Neoplasms	Associate	35193602
Genital Diseases Male	Associate	28302064
Glioma	Associate	37031183
Glomerulonephritis IGA	Associate	36091017
Hand Injuries	Associate	28302064
Head and Neck Neoplasms	Associate	26527316
Heart Diseases	Associate	30224945
Heart Failure	Inhibit	22692818
Hematologic Diseases	Associate	37102608
Hematologic Neoplasms	Associate	34906138
HIV Infections	Associate	37256770
HIV Seropositivity	Stimulate	34107171
Immune System Diseases	Associate	40397075
Infections	Associate	39299377
Inflammation	Associate	17114497, 17382928, 19166933, 21640790, 22272346, 22896623, 24107356, 25550857, 26527316, 28775099, 31194941, 31638178, 32068606, 35690236, 37029363, 37256770, 37735396, 37903473 View all (3 more)
Intellectual Disability	Associate	28302064
Leukemia	Associate	37172199
Leukemia Lymphocytic Chronic B Cell	Associate	30498085
Leukemia Lymphoma Adult T Cell	Associate	34906138
Leukemia Myeloid Acute	Associate	31484791, 37172199
Lung Neoplasms	Associate	20028769, 25550857
Lupus Erythematosus Systemic	Associate	18050247, 21898345, 22904263, 26606652, 31707854, 34931135, 38230454
Lupus Nephritis	Associate	24386384
Lymphatic Metastasis	Associate	25550857
Lymphoma Follicular	Associate	24357726
Lymphoma Large B Cell Diffuse	Associate	21179087
Lymphoma Primary Effusion	Associate	25341731, 32161170
Mannose Binding Protein Deficiency	Associate	32052928
Meningioma	Associate	26943583
Mosaic variegated aneuploidy syndrome	Associate	31515286
Multiple Myeloma	Associate	27454822
Muscle Spasticity	Associate	28302064
Myasthenia Gravis	Associate	32210951
Myelodysplastic Syndromes	Associate	37102608, 37172199, 40397075
Neoplasms	Associate	15720800, 25550857, 26527316, 27340278, 28981114, 29048684, 33380238, 36138026, 36421353
Neoplasms	Stimulate	37031183
Neurocognitive Disorders	Associate	37256770
Obesity	Associate	36552771
Osteoporosis	Associate	12619925
Ovarian Neoplasms	Stimulate	23383610
Pancreatic Neoplasms	Associate	20124483
Pneumonia	Associate	31638178
Precancerous Conditions	Associate	20028769
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	26068967
Psoriasis	Associate	20500689
Pterygium	Associate	36768371
Pulmonary Fibrosis	Associate	21898345, 23444193
Respiratory Distress Syndrome	Associate	28775099
Sarcoidosis	Associate	27402699
Sarcoma Kaposi	Associate	25341731
Scleroderma Diffuse	Associate	23444193
Scleroderma Systemic	Associate	21898345, 23444193, 25569146
Sepsis	Associate	24701036
Severe Acute Respiratory Syndrome	Associate	24701036, 31916109
Sjogren's Syndrome	Associate	36768371
Skin Diseases	Stimulate	19166933
Small Cell Lung Carcinoma	Stimulate	25550857
Spondylitis Ankylosing	Associate	32572893
Squamous Cell Carcinoma of Head and Neck	Associate	26527316
Thyroid Cancer Papillary	Associate	29048684, 31662568
Tuberculosis	Inhibit	32053511
Waldenstrom Macroglobulinemia	Associate	23836557, 25341731

IRAK1 (interleukin 1 receptor associated kinase 1)