Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3643
Gene name Gene Name - the full gene name approved by the HGNC.	Insulin receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	INSR
Synonyms (NCBI Gene) Gene synonyms aliases	CD220, HHF5
Disease Acronyms (UniProt) Disease acronyms from UniProt database	HHF5
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the receptor tyrosine kinase family of proteins. The encoded preproprotein is proteolytically processed to generate alpha and beta subunits that form a heterotetrameric receptor. Binding of insulin or other ligands to this re

Show/Hide all(58)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1799816	C>T	Benign, likely-benign, uncertain-significance, conflicting-interpretations-of-pathogenicity, benign-likely-benign	Coding sequence variant, missense variant
rs41304772	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs52836744	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913135	C>A	Pathogenic	Coding sequence variant, missense variant
rs121913136	T>C	Pathogenic	Coding sequence variant, missense variant
rs121913137	G>A,C	Pathogenic	Coding sequence variant, missense variant, stop gained
rs121913138	C>A	Pathogenic	Coding sequence variant, missense variant
rs121913139	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913140	C>G,T	Pathogenic	Stop gained, coding sequence variant, missense variant
rs121913141	A>C,G	Pathogenic	Coding sequence variant, missense variant
rs121913142	A>C	Pathogenic	Coding sequence variant, missense variant
rs121913143	G>T	Pathogenic	Coding sequence variant, missense variant
rs121913144	G>A	Pathogenic	Coding sequence variant, stop gained
rs121913145	T>C	Pathogenic	Coding sequence variant, missense variant
rs121913146	C>T	Pathogenic	Coding sequence variant, stop gained
rs121913147	T>C	Pathogenic	Coding sequence variant, missense variant
rs121913148	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913150	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913151	G>A	Pathogenic, uncertain-significance	Coding sequence variant, stop gained
rs121913152	A>G	Pathogenic	Coding sequence variant, missense variant
rs121913153	C>A,G,T	Pathogenic	Coding sequence variant, missense variant
rs121913154	G>A,T	Pathogenic	Coding sequence variant, missense variant
rs121913155	T>A	Pathogenic	Coding sequence variant, stop gained
rs121913156	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913157	C>T	Pathogenic	Coding sequence variant, missense variant
rs121913158	C>G	Pathogenic	Coding sequence variant, missense variant
rs121913159	G>C	Pathogenic	Coding sequence variant, missense variant
rs121913160	T>C	Pathogenic	Coding sequence variant, missense variant
rs138528064	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs140573575	C>A,G,T	Benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs140852238	C>T	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs146588336	G>C	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs147125937	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs149795690	A>G	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs201445608	C>G,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs267607184	C>T	Pathogenic	Missense variant, coding sequence variant
rs376497490	G>A,C	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant, intron variant
rs387906538	G>A,C	Pathogenic	Stop gained, coding sequence variant, missense variant
rs587776819	T>C	Pathogenic	Splice acceptor variant
rs587776820	GTCCTGGT>-	Pathogenic	Frameshift variant, coding sequence variant
rs752552480	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs781007453	G>A,C	Pathogenic	Missense variant, coding sequence variant
rs797045624	A>G	Pathogenic	Splice donor variant
rs886037750	C>T	Pathogenic	Missense variant, coding sequence variant
rs1135401737	C>A	Pathogenic	Coding sequence variant, missense variant
rs1135401738	G>A	Pathogenic	Coding sequence variant, missense variant
rs1135401739	C>A	Pathogenic	Coding sequence variant, missense variant
rs1135401740	A>C	Pathogenic	Coding sequence variant, stop gained
rs1135401741	C>T	Pathogenic	Coding sequence variant, missense variant
rs1135401742	T>C	Pathogenic	Coding sequence variant, missense variant
rs1347163319	GTTA>-	Pathogenic	Frameshift variant, coding sequence variant
rs1555689937	A>G	Pathogenic	Coding sequence variant, missense variant
rs1555735951	ATCACTGGCA>CTTCC	Pathogenic	Frameshift variant, coding sequence variant
rs1555736246	GATA>-	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1568426700	G>A	Pathogenic	Coding sequence variant, missense variant
rs1599874183	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1599881881	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1599937180	G>A	Likely-pathogenic	Stop gained, coding sequence variant

Show/Hide all(748)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029227	hsa-miR-26b-5p	Microarray	19088304
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT438296	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	25240198
MIRT495786	hsa-miR-7108-3p	PAR-CLIP	22291592
MIRT495786	hsa-miR-7108-3p	PAR-CLIP	22291592
MIRT731383	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26179126
MIRT731383	hsa-miR-15b-5p	Luciferase reporter assay, qRT-PCR, Western blot	26179126
MIRT495786	hsa-miR-7108-3p	PAR-CLIP	22291592
MIRT495786	hsa-miR-7108-3p	PAR-CLIP	22291592
MIRT1067783	hsa-let-7a	CLIP-seq
MIRT1067784	hsa-let-7b	CLIP-seq
MIRT1067785	hsa-let-7c	CLIP-seq
MIRT1067786	hsa-let-7d	CLIP-seq
MIRT1067787	hsa-let-7e	CLIP-seq
MIRT1067788	hsa-let-7f	CLIP-seq
MIRT1067789	hsa-let-7g	CLIP-seq
MIRT1067790	hsa-let-7i	CLIP-seq
MIRT1067791	hsa-miR-1204	CLIP-seq
MIRT1067792	hsa-miR-1226	CLIP-seq
MIRT1067793	hsa-miR-1236	CLIP-seq
MIRT1067794	hsa-miR-128	CLIP-seq
MIRT1067795	hsa-miR-1283	CLIP-seq
MIRT1067796	hsa-miR-1298	CLIP-seq
MIRT1067797	hsa-miR-1304	CLIP-seq
MIRT1067798	hsa-miR-135a	CLIP-seq
MIRT1067799	hsa-miR-135b	CLIP-seq
MIRT1067800	hsa-miR-150	CLIP-seq
MIRT1067801	hsa-miR-151-3p	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT1067805	hsa-miR-187	CLIP-seq
MIRT1067806	hsa-miR-18a	CLIP-seq
MIRT1067807	hsa-miR-18b	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT1067809	hsa-miR-202	CLIP-seq
MIRT1067810	hsa-miR-218	CLIP-seq
MIRT1067811	hsa-miR-223	CLIP-seq
MIRT1067812	hsa-miR-2355-5p	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067814	hsa-miR-27a	CLIP-seq
MIRT1067815	hsa-miR-27b	CLIP-seq
MIRT1067816	hsa-miR-2964a-5p	CLIP-seq
MIRT1067817	hsa-miR-3065-5p	CLIP-seq
MIRT1067818	hsa-miR-3074-3p	CLIP-seq
MIRT1067819	hsa-miR-3120-3p	CLIP-seq
MIRT1067820	hsa-miR-3125	CLIP-seq
MIRT1067821	hsa-miR-3152-3p	CLIP-seq
MIRT1067822	hsa-miR-3166	CLIP-seq
MIRT1067823	hsa-miR-3177-5p	CLIP-seq
MIRT1067824	hsa-miR-3183	CLIP-seq
MIRT1067825	hsa-miR-3188	CLIP-seq
MIRT1067826	hsa-miR-320a	CLIP-seq
MIRT1067827	hsa-miR-320b	CLIP-seq
MIRT1067828	hsa-miR-320c	CLIP-seq
MIRT1067829	hsa-miR-320d	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT1067831	hsa-miR-342-3p	CLIP-seq
MIRT1067832	hsa-miR-34b	CLIP-seq
MIRT1067833	hsa-miR-34c-3p	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT1067835	hsa-miR-3609	CLIP-seq
MIRT1067836	hsa-miR-3616-5p	CLIP-seq
MIRT1067837	hsa-miR-3647-5p	CLIP-seq
MIRT1067838	hsa-miR-3667-3p	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT1067840	hsa-miR-3916	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT1067842	hsa-miR-3975	CLIP-seq
MIRT1067843	hsa-miR-410	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT1067845	hsa-miR-4277	CLIP-seq
MIRT1067846	hsa-miR-4279	CLIP-seq
MIRT1067847	hsa-miR-4290	CLIP-seq
MIRT1067848	hsa-miR-4293	CLIP-seq
MIRT1067849	hsa-miR-4429	CLIP-seq
MIRT1067850	hsa-miR-4458	CLIP-seq
MIRT1067851	hsa-miR-4463	CLIP-seq
MIRT1067852	hsa-miR-4499	CLIP-seq
MIRT1067853	hsa-miR-4500	CLIP-seq
MIRT1067854	hsa-miR-4524	CLIP-seq
MIRT1067855	hsa-miR-4697-3p	CLIP-seq
MIRT1067856	hsa-miR-4704-3p	CLIP-seq
MIRT1067857	hsa-miR-4709-3p	CLIP-seq
MIRT1067858	hsa-miR-4711-3p	CLIP-seq
MIRT1067859	hsa-miR-4711-5p	CLIP-seq
MIRT1067860	hsa-miR-4717-3p	CLIP-seq
MIRT1067861	hsa-miR-4723-3p	CLIP-seq
MIRT1067862	hsa-miR-4733-3p	CLIP-seq
MIRT1067863	hsa-miR-4735-3p	CLIP-seq
MIRT1067864	hsa-miR-4757-5p	CLIP-seq
MIRT1067865	hsa-miR-4762-3p	CLIP-seq
MIRT1067866	hsa-miR-4766-5p	CLIP-seq
MIRT1067867	hsa-miR-4771	CLIP-seq
MIRT1067868	hsa-miR-4795-5p	CLIP-seq
MIRT1067869	hsa-miR-485-5p	CLIP-seq
MIRT1067870	hsa-miR-488	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT1067872	hsa-miR-503	CLIP-seq
MIRT1067873	hsa-miR-511	CLIP-seq
MIRT1067874	hsa-miR-513a-5p	CLIP-seq
MIRT1067875	hsa-miR-548aa	CLIP-seq
MIRT1067876	hsa-miR-548ah	CLIP-seq
MIRT1067877	hsa-miR-548t	CLIP-seq
MIRT1067878	hsa-miR-561	CLIP-seq
MIRT1067879	hsa-miR-573	CLIP-seq
MIRT1067880	hsa-miR-581	CLIP-seq
MIRT1067881	hsa-miR-587	CLIP-seq
MIRT1067882	hsa-miR-592	CLIP-seq
MIRT1067883	hsa-miR-597	CLIP-seq
MIRT1067884	hsa-miR-599	CLIP-seq
MIRT1067885	hsa-miR-603	CLIP-seq
MIRT1067886	hsa-miR-605	CLIP-seq
MIRT1067887	hsa-miR-607	CLIP-seq
MIRT1067888	hsa-miR-630	CLIP-seq
MIRT1067889	hsa-miR-636	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT1067891	hsa-miR-676	CLIP-seq
MIRT1067892	hsa-miR-922	CLIP-seq
MIRT1067893	hsa-miR-98	CLIP-seq
MIRT1067783	hsa-let-7a	CLIP-seq
MIRT1067784	hsa-let-7b	CLIP-seq
MIRT1067785	hsa-let-7c	CLIP-seq
MIRT1067786	hsa-let-7d	CLIP-seq
MIRT1067787	hsa-let-7e	CLIP-seq
MIRT1067788	hsa-let-7f	CLIP-seq
MIRT1067789	hsa-let-7g	CLIP-seq
MIRT1067790	hsa-let-7i	CLIP-seq
MIRT1067894	hsa-miR-1224-5p	CLIP-seq
MIRT1067797	hsa-miR-1304	CLIP-seq
MIRT1067801	hsa-miR-151-3p	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT1067809	hsa-miR-202	CLIP-seq
MIRT1067826	hsa-miR-320a	CLIP-seq
MIRT1067827	hsa-miR-320b	CLIP-seq
MIRT1067828	hsa-miR-320c	CLIP-seq
MIRT1067829	hsa-miR-320d	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT1067831	hsa-miR-342-3p	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT1067895	hsa-miR-3915	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT1067896	hsa-miR-3928	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT1067849	hsa-miR-4429	CLIP-seq
MIRT1067850	hsa-miR-4458	CLIP-seq
MIRT1067851	hsa-miR-4463	CLIP-seq
MIRT1067852	hsa-miR-4499	CLIP-seq
MIRT1067853	hsa-miR-4500	CLIP-seq
MIRT1067897	hsa-miR-4517	CLIP-seq
MIRT1067898	hsa-miR-4689	CLIP-seq
MIRT1067860	hsa-miR-4717-3p	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT1067893	hsa-miR-98	CLIP-seq
MIRT2016442	hsa-miR-1200	CLIP-seq
MIRT1067791	hsa-miR-1204	CLIP-seq
MIRT2016443	hsa-miR-1252	CLIP-seq
MIRT2016444	hsa-miR-1253	CLIP-seq
MIRT2016445	hsa-miR-1255a	CLIP-seq
MIRT2016446	hsa-miR-1255b	CLIP-seq
MIRT2016447	hsa-miR-1292	CLIP-seq
MIRT1067800	hsa-miR-150	CLIP-seq
MIRT2016448	hsa-miR-185	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT1067810	hsa-miR-218	CLIP-seq
MIRT2016450	hsa-miR-24	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067819	hsa-miR-3120-3p	CLIP-seq
MIRT1067825	hsa-miR-3188	CLIP-seq
MIRT2016451	hsa-miR-3194-3p	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT1067832	hsa-miR-34b	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT2016452	hsa-miR-3611	CLIP-seq
MIRT2016453	hsa-miR-3653	CLIP-seq
MIRT2016454	hsa-miR-3670	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT2016455	hsa-miR-3942-5p	CLIP-seq
MIRT1067842	hsa-miR-3975	CLIP-seq
MIRT2016456	hsa-miR-4258	CLIP-seq
MIRT2016457	hsa-miR-4268	CLIP-seq
MIRT1067845	hsa-miR-4277	CLIP-seq
MIRT2016458	hsa-miR-4306	CLIP-seq
MIRT2016459	hsa-miR-432	CLIP-seq
MIRT2016460	hsa-miR-4327	CLIP-seq
MIRT2016461	hsa-miR-4427	CLIP-seq
MIRT2016462	hsa-miR-4428	CLIP-seq
MIRT2016463	hsa-miR-4434	CLIP-seq
MIRT2016464	hsa-miR-4476	CLIP-seq
MIRT2016465	hsa-miR-450b-3p	CLIP-seq
MIRT2016466	hsa-miR-4516	CLIP-seq
MIRT2016467	hsa-miR-4525	CLIP-seq
MIRT2016468	hsa-miR-4533	CLIP-seq
MIRT2016469	hsa-miR-4635	CLIP-seq
MIRT2016470	hsa-miR-4644	CLIP-seq
MIRT2016471	hsa-miR-4680-3p	CLIP-seq
MIRT2016472	hsa-miR-4699-3p	CLIP-seq
MIRT2016473	hsa-miR-4703-5p	CLIP-seq
MIRT2016474	hsa-miR-4707-3p	CLIP-seq
MIRT2016475	hsa-miR-4713-5p	CLIP-seq
MIRT2016476	hsa-miR-4716-3p	CLIP-seq
MIRT2016477	hsa-miR-4731-3p	CLIP-seq
MIRT1067864	hsa-miR-4757-5p	CLIP-seq
MIRT2016478	hsa-miR-4780	CLIP-seq
MIRT2016479	hsa-miR-4801	CLIP-seq
MIRT1067869	hsa-miR-485-5p	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2016481	hsa-miR-532-3p	CLIP-seq
MIRT2016482	hsa-miR-544b	CLIP-seq
MIRT2016483	hsa-miR-545	CLIP-seq
MIRT2016484	hsa-miR-552	CLIP-seq
MIRT2016485	hsa-miR-556-5p	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT2016487	hsa-miR-580	CLIP-seq
MIRT1067882	hsa-miR-592	CLIP-seq
MIRT1067884	hsa-miR-599	CLIP-seq
MIRT2016488	hsa-miR-634	CLIP-seq
MIRT2016489	hsa-miR-642b	CLIP-seq
MIRT2016490	hsa-miR-769-3p	CLIP-seq
MIRT1067783	hsa-let-7a	CLIP-seq
MIRT1067784	hsa-let-7b	CLIP-seq
MIRT1067785	hsa-let-7c	CLIP-seq
MIRT1067786	hsa-let-7d	CLIP-seq
MIRT1067787	hsa-let-7e	CLIP-seq
MIRT1067788	hsa-let-7f	CLIP-seq
MIRT1067789	hsa-let-7g	CLIP-seq
MIRT1067790	hsa-let-7i	CLIP-seq
MIRT2248690	hsa-miR-1208	CLIP-seq
MIRT1067894	hsa-miR-1224-5p	CLIP-seq
MIRT2248691	hsa-miR-1245b-3p	CLIP-seq
MIRT2016444	hsa-miR-1253	CLIP-seq
MIRT2248692	hsa-miR-1254	CLIP-seq
MIRT2248693	hsa-miR-1278	CLIP-seq
MIRT2248694	hsa-miR-129-5p	CLIP-seq
MIRT2248695	hsa-miR-1470	CLIP-seq
MIRT1067801	hsa-miR-151-3p	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT1067809	hsa-miR-202	CLIP-seq
MIRT2248696	hsa-miR-2110	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT2248697	hsa-miR-2277-3p	CLIP-seq
MIRT1067818	hsa-miR-3074-3p	CLIP-seq
MIRT2248698	hsa-miR-3116	CLIP-seq
MIRT1067820	hsa-miR-3125	CLIP-seq
MIRT2248699	hsa-miR-3127-3p	CLIP-seq
MIRT2248700	hsa-miR-3150a-3p	CLIP-seq
MIRT2248701	hsa-miR-3165	CLIP-seq
MIRT2248702	hsa-miR-3173-3p	CLIP-seq
MIRT2248703	hsa-miR-3182	CLIP-seq
MIRT2248704	hsa-miR-3186-5p	CLIP-seq
MIRT2248705	hsa-miR-323-5p	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT2248706	hsa-miR-345	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT2248707	hsa-miR-3613-3p	CLIP-seq
MIRT2248708	hsa-miR-3622a-3p	CLIP-seq
MIRT2248709	hsa-miR-3622b-3p	CLIP-seq
MIRT2248710	hsa-miR-3664-3p	CLIP-seq
MIRT2248711	hsa-miR-3685	CLIP-seq
MIRT2248712	hsa-miR-3686	CLIP-seq
MIRT2248713	hsa-miR-371b-5p	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT2248714	hsa-miR-384	CLIP-seq
MIRT2248715	hsa-miR-3907	CLIP-seq
MIRT1067840	hsa-miR-3916	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT2248716	hsa-miR-3974	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT2248717	hsa-miR-4260	CLIP-seq
MIRT2248718	hsa-miR-4271	CLIP-seq
MIRT1067846	hsa-miR-4279	CLIP-seq
MIRT2248719	hsa-miR-4307	CLIP-seq
MIRT2248720	hsa-miR-4311	CLIP-seq
MIRT2248721	hsa-miR-4320	CLIP-seq
MIRT2248722	hsa-miR-4420	CLIP-seq
MIRT2248723	hsa-miR-4422	CLIP-seq
MIRT1067850	hsa-miR-4458	CLIP-seq
MIRT1067851	hsa-miR-4463	CLIP-seq
MIRT2248724	hsa-miR-4464	CLIP-seq
MIRT2248725	hsa-miR-4469	CLIP-seq
MIRT2248726	hsa-miR-4484	CLIP-seq
MIRT2248727	hsa-miR-4496	CLIP-seq
MIRT1067852	hsa-miR-4499	CLIP-seq
MIRT1067853	hsa-miR-4500	CLIP-seq
MIRT2248728	hsa-miR-450b-5p	CLIP-seq
MIRT2248729	hsa-miR-4666-5p	CLIP-seq
MIRT2248730	hsa-miR-4667-3p	CLIP-seq
MIRT2248731	hsa-miR-4677-5p	CLIP-seq
MIRT2248732	hsa-miR-4691-5p	CLIP-seq
MIRT1067856	hsa-miR-4704-3p	CLIP-seq
MIRT1067859	hsa-miR-4711-5p	CLIP-seq
MIRT2248733	hsa-miR-4725-3p	CLIP-seq
MIRT2016477	hsa-miR-4731-3p	CLIP-seq
MIRT2248734	hsa-miR-4733-5p	CLIP-seq
MIRT2248735	hsa-miR-4748	CLIP-seq
MIRT2248736	hsa-miR-4751	CLIP-seq
MIRT1067866	hsa-miR-4766-5p	CLIP-seq
MIRT2016479	hsa-miR-4801	CLIP-seq
MIRT2248737	hsa-miR-4802-3p	CLIP-seq
MIRT2248738	hsa-miR-483-3p	CLIP-seq
MIRT2248739	hsa-miR-490-5p	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT2248740	hsa-miR-499-3p	CLIP-seq
MIRT2248741	hsa-miR-499a-3p	CLIP-seq
MIRT2248742	hsa-miR-505	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2248743	hsa-miR-518a-5p	CLIP-seq
MIRT2248744	hsa-miR-520d-5p	CLIP-seq
MIRT2248745	hsa-miR-524-5p	CLIP-seq
MIRT2248746	hsa-miR-527	CLIP-seq
MIRT1067877	hsa-miR-548t	CLIP-seq
MIRT2248747	hsa-miR-556-3p	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT2016488	hsa-miR-634	CLIP-seq
MIRT2016489	hsa-miR-642b	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT2248748	hsa-miR-670	CLIP-seq
MIRT2248749	hsa-miR-873	CLIP-seq
MIRT2248750	hsa-miR-876-3p	CLIP-seq
MIRT2248751	hsa-miR-889	CLIP-seq
MIRT2248752	hsa-miR-890	CLIP-seq
MIRT2248753	hsa-miR-892a	CLIP-seq
MIRT1067893	hsa-miR-98	CLIP-seq
MIRT1067783	hsa-let-7a	CLIP-seq
MIRT1067784	hsa-let-7b	CLIP-seq
MIRT1067785	hsa-let-7c	CLIP-seq
MIRT1067786	hsa-let-7d	CLIP-seq
MIRT1067787	hsa-let-7e	CLIP-seq
MIRT1067788	hsa-let-7f	CLIP-seq
MIRT1067789	hsa-let-7g	CLIP-seq
MIRT1067790	hsa-let-7i	CLIP-seq
MIRT1067801	hsa-miR-151-3p	CLIP-seq
MIRT1067809	hsa-miR-202	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT1067811	hsa-miR-223	CLIP-seq
MIRT1067822	hsa-miR-3166	CLIP-seq
MIRT1067832	hsa-miR-34b	CLIP-seq
MIRT1067834	hsa-miR-3529	CLIP-seq
MIRT2248708	hsa-miR-3622a-3p	CLIP-seq
MIRT2248709	hsa-miR-3622b-3p	CLIP-seq
MIRT1067839	hsa-miR-379	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT1067845	hsa-miR-4277	CLIP-seq
MIRT1067850	hsa-miR-4458	CLIP-seq
MIRT1067851	hsa-miR-4463	CLIP-seq
MIRT1067852	hsa-miR-4499	CLIP-seq
MIRT1067853	hsa-miR-4500	CLIP-seq
MIRT2016469	hsa-miR-4635	CLIP-seq
MIRT2248731	hsa-miR-4677-5p	CLIP-seq
MIRT1067855	hsa-miR-4697-3p	CLIP-seq
MIRT1067867	hsa-miR-4771	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT1067880	hsa-miR-581	CLIP-seq
MIRT1067882	hsa-miR-592	CLIP-seq
MIRT1067883	hsa-miR-597	CLIP-seq
MIRT1067884	hsa-miR-599	CLIP-seq
MIRT1067893	hsa-miR-98	CLIP-seq
MIRT2437902	hsa-miR-127-5p	CLIP-seq
MIRT2437903	hsa-miR-1324	CLIP-seq
MIRT2437904	hsa-miR-4724-5p	CLIP-seq
MIRT1067873	hsa-miR-511	CLIP-seq
MIRT2248692	hsa-miR-1254	CLIP-seq
MIRT2248695	hsa-miR-1470	CLIP-seq
MIRT2451885	hsa-miR-205	CLIP-seq
MIRT2248698	hsa-miR-3116	CLIP-seq
MIRT2248699	hsa-miR-3127-3p	CLIP-seq
MIRT2451886	hsa-miR-3157-5p	CLIP-seq
MIRT2248725	hsa-miR-4469	CLIP-seq
MIRT2248730	hsa-miR-4667-3p	CLIP-seq
MIRT2451887	hsa-miR-4668-3p	CLIP-seq
MIRT2451888	hsa-miR-4758-3p	CLIP-seq
MIRT2451889	hsa-miR-500a	CLIP-seq
MIRT2451890	hsa-miR-548c-3p	CLIP-seq
MIRT1067791	hsa-miR-1204	CLIP-seq
MIRT2248690	hsa-miR-1208	CLIP-seq
MIRT1067894	hsa-miR-1224-5p	CLIP-seq
MIRT1067792	hsa-miR-1226	CLIP-seq
MIRT2016443	hsa-miR-1252	CLIP-seq
MIRT2016444	hsa-miR-1253	CLIP-seq
MIRT2248692	hsa-miR-1254	CLIP-seq
MIRT2016445	hsa-miR-1255a	CLIP-seq
MIRT2016446	hsa-miR-1255b	CLIP-seq
MIRT2552287	hsa-miR-125a-3p	CLIP-seq
MIRT2552288	hsa-miR-125a-5p	CLIP-seq
MIRT2552289	hsa-miR-125b	CLIP-seq
MIRT2552290	hsa-miR-1271	CLIP-seq
MIRT2552291	hsa-miR-1279	CLIP-seq
MIRT2248694	hsa-miR-129-5p	CLIP-seq
MIRT1067796	hsa-miR-1298	CLIP-seq
MIRT1067797	hsa-miR-1304	CLIP-seq
MIRT1067798	hsa-miR-135a	CLIP-seq
MIRT1067799	hsa-miR-135b	CLIP-seq
MIRT2552292	hsa-miR-140-3p	CLIP-seq
MIRT2248695	hsa-miR-1470	CLIP-seq
MIRT1067800	hsa-miR-150	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT2552293	hsa-miR-181a	CLIP-seq
MIRT2552294	hsa-miR-181b	CLIP-seq
MIRT2552295	hsa-miR-181c	CLIP-seq
MIRT2552296	hsa-miR-181d	CLIP-seq
MIRT2552297	hsa-miR-182	CLIP-seq
MIRT2016448	hsa-miR-185	CLIP-seq
MIRT2552298	hsa-miR-186	CLIP-seq
MIRT1067805	hsa-miR-187	CLIP-seq
MIRT1067806	hsa-miR-18a	CLIP-seq
MIRT1067807	hsa-miR-18b	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT2451885	hsa-miR-205	CLIP-seq
MIRT2552299	hsa-miR-208a	CLIP-seq
MIRT2552300	hsa-miR-208b	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT2552301	hsa-miR-216a	CLIP-seq
MIRT1067810	hsa-miR-218	CLIP-seq
MIRT1067812	hsa-miR-2355-5p	CLIP-seq
MIRT2552302	hsa-miR-2467-3p	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067816	hsa-miR-2964a-5p	CLIP-seq
MIRT1067817	hsa-miR-3065-5p	CLIP-seq
MIRT1067818	hsa-miR-3074-3p	CLIP-seq
MIRT2248698	hsa-miR-3116	CLIP-seq
MIRT2248699	hsa-miR-3127-3p	CLIP-seq
MIRT2552303	hsa-miR-3133	CLIP-seq
MIRT1067821	hsa-miR-3152-3p	CLIP-seq
MIRT2451886	hsa-miR-3157-5p	CLIP-seq
MIRT2552304	hsa-miR-3163	CLIP-seq
MIRT1067823	hsa-miR-3177-5p	CLIP-seq
MIRT1067824	hsa-miR-3183	CLIP-seq
MIRT2552305	hsa-miR-3185	CLIP-seq
MIRT1067825	hsa-miR-3188	CLIP-seq
MIRT1067826	hsa-miR-320a	CLIP-seq
MIRT1067827	hsa-miR-320b	CLIP-seq
MIRT1067828	hsa-miR-320c	CLIP-seq
MIRT1067829	hsa-miR-320d	CLIP-seq
MIRT2552306	hsa-miR-323b-3p	CLIP-seq
MIRT2552307	hsa-miR-329	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT2552308	hsa-miR-339-5p	CLIP-seq
MIRT1067831	hsa-miR-342-3p	CLIP-seq
MIRT2248706	hsa-miR-345	CLIP-seq
MIRT1067835	hsa-miR-3609	CLIP-seq
MIRT2248707	hsa-miR-3613-3p	CLIP-seq
MIRT2552309	hsa-miR-3618	CLIP-seq
MIRT2552310	hsa-miR-362-3p	CLIP-seq
MIRT2016453	hsa-miR-3653	CLIP-seq
MIRT2552311	hsa-miR-3658	CLIP-seq
MIRT2552312	hsa-miR-3663-3p	CLIP-seq
MIRT2248710	hsa-miR-3664-3p	CLIP-seq
MIRT2552313	hsa-miR-3667-5p	CLIP-seq
MIRT2016454	hsa-miR-3670	CLIP-seq
MIRT2552314	hsa-miR-3678-3p	CLIP-seq
MIRT2552315	hsa-miR-3690	CLIP-seq
MIRT2552316	hsa-miR-371-5p	CLIP-seq
MIRT2248713	hsa-miR-371b-5p	CLIP-seq
MIRT2552317	hsa-miR-377	CLIP-seq
MIRT2552318	hsa-miR-382	CLIP-seq
MIRT2552319	hsa-miR-3908	CLIP-seq
MIRT2552320	hsa-miR-3912	CLIP-seq
MIRT1067895	hsa-miR-3915	CLIP-seq
MIRT1067841	hsa-miR-3927	CLIP-seq
MIRT1067896	hsa-miR-3928	CLIP-seq
MIRT2552321	hsa-miR-3938	CLIP-seq
MIRT2552322	hsa-miR-3941	CLIP-seq
MIRT2016455	hsa-miR-3942-5p	CLIP-seq
MIRT1067842	hsa-miR-3975	CLIP-seq
MIRT1067843	hsa-miR-410	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT2552323	hsa-miR-4254	CLIP-seq
MIRT2016456	hsa-miR-4258	CLIP-seq
MIRT2552324	hsa-miR-4262	CLIP-seq
MIRT2016457	hsa-miR-4268	CLIP-seq
MIRT2552325	hsa-miR-4274	CLIP-seq
MIRT1067846	hsa-miR-4279	CLIP-seq
MIRT2552326	hsa-miR-4286	CLIP-seq
MIRT2552327	hsa-miR-4304	CLIP-seq
MIRT2016458	hsa-miR-4306	CLIP-seq
MIRT2552328	hsa-miR-4319	CLIP-seq
MIRT2552329	hsa-miR-433	CLIP-seq
MIRT2248722	hsa-miR-4420	CLIP-seq
MIRT2248723	hsa-miR-4422	CLIP-seq
MIRT2016462	hsa-miR-4428	CLIP-seq
MIRT1067849	hsa-miR-4429	CLIP-seq
MIRT2552330	hsa-miR-4446-5p	CLIP-seq
MIRT2552331	hsa-miR-4457	CLIP-seq
MIRT2248725	hsa-miR-4469	CLIP-seq
MIRT2552332	hsa-miR-4470	CLIP-seq
MIRT2016464	hsa-miR-4476	CLIP-seq
MIRT2016465	hsa-miR-450b-3p	CLIP-seq
MIRT2552333	hsa-miR-4514	CLIP-seq
MIRT1067897	hsa-miR-4517	CLIP-seq
MIRT2552334	hsa-miR-4522	CLIP-seq
MIRT1067854	hsa-miR-4524	CLIP-seq
MIRT2016467	hsa-miR-4525	CLIP-seq
MIRT2552335	hsa-miR-4532	CLIP-seq
MIRT2016468	hsa-miR-4533	CLIP-seq
MIRT2016470	hsa-miR-4644	CLIP-seq
MIRT2552336	hsa-miR-4649-5p	CLIP-seq
MIRT2552337	hsa-miR-4650-3p	CLIP-seq
MIRT2552338	hsa-miR-4652-3p	CLIP-seq
MIRT2552339	hsa-miR-4662a-3p	CLIP-seq
MIRT2248729	hsa-miR-4666-5p	CLIP-seq
MIRT2248730	hsa-miR-4667-3p	CLIP-seq
MIRT2451887	hsa-miR-4668-3p	CLIP-seq
MIRT2248731	hsa-miR-4677-5p	CLIP-seq
MIRT1067898	hsa-miR-4689	CLIP-seq
MIRT2552340	hsa-miR-4692	CLIP-seq
MIRT2552341	hsa-miR-4694-3p	CLIP-seq
MIRT2016472	hsa-miR-4699-3p	CLIP-seq
MIRT2016473	hsa-miR-4703-5p	CLIP-seq
MIRT1067857	hsa-miR-4709-3p	CLIP-seq
MIRT2552342	hsa-miR-4712-3p	CLIP-seq
MIRT2016475	hsa-miR-4713-5p	CLIP-seq
MIRT2016476	hsa-miR-4716-3p	CLIP-seq
MIRT1067860	hsa-miR-4717-3p	CLIP-seq
MIRT2552343	hsa-miR-4717-5p	CLIP-seq
MIRT2552344	hsa-miR-4718	CLIP-seq
MIRT1067861	hsa-miR-4723-3p	CLIP-seq
MIRT2016477	hsa-miR-4731-3p	CLIP-seq
MIRT2552345	hsa-miR-4732-3p	CLIP-seq
MIRT1067862	hsa-miR-4733-3p	CLIP-seq
MIRT2248734	hsa-miR-4733-5p	CLIP-seq
MIRT1067863	hsa-miR-4735-3p	CLIP-seq
MIRT2552346	hsa-miR-4742-3p	CLIP-seq
MIRT1067864	hsa-miR-4757-5p	CLIP-seq
MIRT2451888	hsa-miR-4758-3p	CLIP-seq
MIRT1067865	hsa-miR-4762-3p	CLIP-seq
MIRT2552347	hsa-miR-4766-3p	CLIP-seq
MIRT1067866	hsa-miR-4766-5p	CLIP-seq
MIRT2016478	hsa-miR-4780	CLIP-seq
MIRT2016479	hsa-miR-4801	CLIP-seq
MIRT1067869	hsa-miR-485-5p	CLIP-seq
MIRT2248739	hsa-miR-490-5p	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT2552348	hsa-miR-499-5p	CLIP-seq
MIRT2451889	hsa-miR-500a	CLIP-seq
MIRT1067872	hsa-miR-503	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2552349	hsa-miR-510	CLIP-seq
MIRT2552350	hsa-miR-513a-3p	CLIP-seq
MIRT2552351	hsa-miR-517b	CLIP-seq
MIRT2248744	hsa-miR-520d-5p	CLIP-seq
MIRT2552352	hsa-miR-520g	CLIP-seq
MIRT2552353	hsa-miR-520h	CLIP-seq
MIRT2248745	hsa-miR-524-5p	CLIP-seq
MIRT2016481	hsa-miR-532-3p	CLIP-seq
MIRT2552354	hsa-miR-532-5p	CLIP-seq
MIRT2016483	hsa-miR-545	CLIP-seq
MIRT1067875	hsa-miR-548aa	CLIP-seq
MIRT1067876	hsa-miR-548ah	CLIP-seq
MIRT2552355	hsa-miR-548b-3p	CLIP-seq
MIRT2451890	hsa-miR-548c-3p	CLIP-seq
MIRT1067877	hsa-miR-548t	CLIP-seq
MIRT2552356	hsa-miR-550a	CLIP-seq
MIRT2016485	hsa-miR-556-5p	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT2016487	hsa-miR-580	CLIP-seq
MIRT2552357	hsa-miR-583	CLIP-seq
MIRT1067885	hsa-miR-603	CLIP-seq
MIRT2552358	hsa-miR-624	CLIP-seq
MIRT1067888	hsa-miR-630	CLIP-seq
MIRT1067889	hsa-miR-636	CLIP-seq
MIRT2016489	hsa-miR-642b	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT2248748	hsa-miR-670	CLIP-seq
MIRT2552359	hsa-miR-671-3p	CLIP-seq
MIRT2552360	hsa-miR-7	CLIP-seq
MIRT2016490	hsa-miR-769-3p	CLIP-seq
MIRT2248749	hsa-miR-873	CLIP-seq
MIRT2248751	hsa-miR-889	CLIP-seq
MIRT2552361	hsa-miR-934	CLIP-seq
MIRT2552362	hsa-miR-96	CLIP-seq
MIRT1067791	hsa-miR-1204	CLIP-seq
MIRT1067894	hsa-miR-1224-5p	CLIP-seq
MIRT1067792	hsa-miR-1226	CLIP-seq
MIRT2016443	hsa-miR-1252	CLIP-seq
MIRT2016444	hsa-miR-1253	CLIP-seq
MIRT2248692	hsa-miR-1254	CLIP-seq
MIRT2016445	hsa-miR-1255a	CLIP-seq
MIRT2016446	hsa-miR-1255b	CLIP-seq
MIRT2552287	hsa-miR-125a-3p	CLIP-seq
MIRT2552290	hsa-miR-1271	CLIP-seq
MIRT2552291	hsa-miR-1279	CLIP-seq
MIRT2248694	hsa-miR-129-5p	CLIP-seq
MIRT1067796	hsa-miR-1298	CLIP-seq
MIRT1067797	hsa-miR-1304	CLIP-seq
MIRT1067798	hsa-miR-135a	CLIP-seq
MIRT1067799	hsa-miR-135b	CLIP-seq
MIRT2248695	hsa-miR-1470	CLIP-seq
MIRT1067800	hsa-miR-150	CLIP-seq
MIRT1067802	hsa-miR-15a	CLIP-seq
MIRT1067803	hsa-miR-15b	CLIP-seq
MIRT1067804	hsa-miR-16	CLIP-seq
MIRT2552293	hsa-miR-181a	CLIP-seq
MIRT2552294	hsa-miR-181b	CLIP-seq
MIRT2552295	hsa-miR-181c	CLIP-seq
MIRT2552296	hsa-miR-181d	CLIP-seq
MIRT2552297	hsa-miR-182	CLIP-seq
MIRT2016448	hsa-miR-185	CLIP-seq
MIRT2552298	hsa-miR-186	CLIP-seq
MIRT1067806	hsa-miR-18a	CLIP-seq
MIRT1067807	hsa-miR-18b	CLIP-seq
MIRT1067808	hsa-miR-195	CLIP-seq
MIRT2451885	hsa-miR-205	CLIP-seq
MIRT2552299	hsa-miR-208a	CLIP-seq
MIRT2552300	hsa-miR-208b	CLIP-seq
MIRT2016449	hsa-miR-2116	CLIP-seq
MIRT1067810	hsa-miR-218	CLIP-seq
MIRT1067812	hsa-miR-2355-5p	CLIP-seq
MIRT2552302	hsa-miR-2467-3p	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067817	hsa-miR-3065-5p	CLIP-seq
MIRT2248698	hsa-miR-3116	CLIP-seq
MIRT2248699	hsa-miR-3127-3p	CLIP-seq
MIRT2552303	hsa-miR-3133	CLIP-seq
MIRT1067821	hsa-miR-3152-3p	CLIP-seq
MIRT2451886	hsa-miR-3157-5p	CLIP-seq
MIRT2552304	hsa-miR-3163	CLIP-seq
MIRT1067823	hsa-miR-3177-5p	CLIP-seq
MIRT1067824	hsa-miR-3183	CLIP-seq
MIRT2552305	hsa-miR-3185	CLIP-seq
MIRT1067825	hsa-miR-3188	CLIP-seq
MIRT2552307	hsa-miR-329	CLIP-seq
MIRT1067830	hsa-miR-330-3p	CLIP-seq
MIRT2552308	hsa-miR-339-5p	CLIP-seq
MIRT1067835	hsa-miR-3609	CLIP-seq
MIRT2248707	hsa-miR-3613-3p	CLIP-seq
MIRT2552310	hsa-miR-362-3p	CLIP-seq
MIRT2016453	hsa-miR-3653	CLIP-seq
MIRT2552311	hsa-miR-3658	CLIP-seq
MIRT2248710	hsa-miR-3664-3p	CLIP-seq
MIRT2552313	hsa-miR-3667-5p	CLIP-seq
MIRT2016454	hsa-miR-3670	CLIP-seq
MIRT2552314	hsa-miR-3678-3p	CLIP-seq
MIRT2552315	hsa-miR-3690	CLIP-seq
MIRT2552317	hsa-miR-377	CLIP-seq
MIRT2552318	hsa-miR-382	CLIP-seq
MIRT2552320	hsa-miR-3912	CLIP-seq
MIRT1067895	hsa-miR-3915	CLIP-seq
MIRT1067896	hsa-miR-3928	CLIP-seq
MIRT2552321	hsa-miR-3938	CLIP-seq
MIRT2552322	hsa-miR-3941	CLIP-seq
MIRT2016455	hsa-miR-3942-5p	CLIP-seq
MIRT1067842	hsa-miR-3975	CLIP-seq
MIRT1067843	hsa-miR-410	CLIP-seq
MIRT1067844	hsa-miR-424	CLIP-seq
MIRT2552323	hsa-miR-4254	CLIP-seq
MIRT2016456	hsa-miR-4258	CLIP-seq
MIRT2552324	hsa-miR-4262	CLIP-seq
MIRT2016457	hsa-miR-4268	CLIP-seq
MIRT2552325	hsa-miR-4274	CLIP-seq
MIRT1067846	hsa-miR-4279	CLIP-seq
MIRT2552326	hsa-miR-4286	CLIP-seq
MIRT2552327	hsa-miR-4304	CLIP-seq
MIRT2016458	hsa-miR-4306	CLIP-seq
MIRT2552329	hsa-miR-433	CLIP-seq
MIRT2248723	hsa-miR-4422	CLIP-seq
MIRT2016462	hsa-miR-4428	CLIP-seq
MIRT2552330	hsa-miR-4446-5p	CLIP-seq
MIRT2248725	hsa-miR-4469	CLIP-seq
MIRT2552332	hsa-miR-4470	CLIP-seq
MIRT2016464	hsa-miR-4476	CLIP-seq
MIRT2552333	hsa-miR-4514	CLIP-seq
MIRT1067897	hsa-miR-4517	CLIP-seq
MIRT2552334	hsa-miR-4522	CLIP-seq
MIRT1067854	hsa-miR-4524	CLIP-seq
MIRT2016467	hsa-miR-4525	CLIP-seq
MIRT2552335	hsa-miR-4532	CLIP-seq
MIRT2016468	hsa-miR-4533	CLIP-seq
MIRT2016470	hsa-miR-4644	CLIP-seq
MIRT2552336	hsa-miR-4649-5p	CLIP-seq
MIRT2248729	hsa-miR-4666-5p	CLIP-seq
MIRT2248730	hsa-miR-4667-3p	CLIP-seq
MIRT2451887	hsa-miR-4668-3p	CLIP-seq
MIRT1067898	hsa-miR-4689	CLIP-seq
MIRT2552340	hsa-miR-4692	CLIP-seq
MIRT2552341	hsa-miR-4694-3p	CLIP-seq
MIRT2016472	hsa-miR-4699-3p	CLIP-seq
MIRT2016473	hsa-miR-4703-5p	CLIP-seq
MIRT1067857	hsa-miR-4709-3p	CLIP-seq
MIRT2552342	hsa-miR-4712-3p	CLIP-seq
MIRT2016475	hsa-miR-4713-5p	CLIP-seq
MIRT2016476	hsa-miR-4716-3p	CLIP-seq
MIRT2552343	hsa-miR-4717-5p	CLIP-seq
MIRT2552344	hsa-miR-4718	CLIP-seq
MIRT1067861	hsa-miR-4723-3p	CLIP-seq
MIRT2016477	hsa-miR-4731-3p	CLIP-seq
MIRT1067862	hsa-miR-4733-3p	CLIP-seq
MIRT2248734	hsa-miR-4733-5p	CLIP-seq
MIRT1067863	hsa-miR-4735-3p	CLIP-seq
MIRT2552346	hsa-miR-4742-3p	CLIP-seq
MIRT1067864	hsa-miR-4757-5p	CLIP-seq
MIRT2451888	hsa-miR-4758-3p	CLIP-seq
MIRT1067865	hsa-miR-4762-3p	CLIP-seq
MIRT2016478	hsa-miR-4780	CLIP-seq
MIRT2016479	hsa-miR-4801	CLIP-seq
MIRT1067869	hsa-miR-485-5p	CLIP-seq
MIRT2248739	hsa-miR-490-5p	CLIP-seq
MIRT1067871	hsa-miR-497	CLIP-seq
MIRT2552348	hsa-miR-499-5p	CLIP-seq
MIRT2451889	hsa-miR-500a	CLIP-seq
MIRT1067872	hsa-miR-503	CLIP-seq
MIRT2016480	hsa-miR-507	CLIP-seq
MIRT2552349	hsa-miR-510	CLIP-seq
MIRT2552350	hsa-miR-513a-3p	CLIP-seq
MIRT2248744	hsa-miR-520d-5p	CLIP-seq
MIRT2248745	hsa-miR-524-5p	CLIP-seq
MIRT2016481	hsa-miR-532-3p	CLIP-seq
MIRT2552354	hsa-miR-532-5p	CLIP-seq
MIRT2016483	hsa-miR-545	CLIP-seq
MIRT1067875	hsa-miR-548aa	CLIP-seq
MIRT1067876	hsa-miR-548ah	CLIP-seq
MIRT2552355	hsa-miR-548b-3p	CLIP-seq
MIRT2451890	hsa-miR-548c-3p	CLIP-seq
MIRT1067877	hsa-miR-548t	CLIP-seq
MIRT2016485	hsa-miR-556-5p	CLIP-seq
MIRT2016486	hsa-miR-557	CLIP-seq
MIRT2016487	hsa-miR-580	CLIP-seq
MIRT2552357	hsa-miR-583	CLIP-seq
MIRT1067885	hsa-miR-603	CLIP-seq
MIRT1067888	hsa-miR-630	CLIP-seq
MIRT1067889	hsa-miR-636	CLIP-seq
MIRT2016489	hsa-miR-642b	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT2248748	hsa-miR-670	CLIP-seq
MIRT2552360	hsa-miR-7	CLIP-seq
MIRT2248749	hsa-miR-873	CLIP-seq
MIRT2552362	hsa-miR-96	CLIP-seq
MIRT2451885	hsa-miR-205	CLIP-seq
MIRT1067813	hsa-miR-2467-5p	CLIP-seq
MIRT1067890	hsa-miR-646	CLIP-seq
MIRT2248748	hsa-miR-670	CLIP-seq

Transcription factors

Show/Hide all(7)

Transcription factor	Regulation	Reference
CEBPA	Activation	8288055
CEBPB	Activation	8288055
ESR2	Repression	22099628
HMGA1	Activation	16707431
HMGA1	Repression	17434141
SP1	Activation	1311316;16707431
SP1	Unknown	7983788

Show/Hide all(93)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000187	Process	Activation of MAPK activity	IMP	17001305
GO:0001540	Function	Amyloid-beta binding	IPI	19406747
GO:0001934	Process	Positive regulation of protein phosphorylation	IDA	7556070
GO:0002092	Process	Positive regulation of receptor internalization	IDA	25401701
GO:0003007	Process	Heart morphogenesis	IMP	7693131
GO:0004713	Function	Protein tyrosine kinase activity	IDA	8496180
GO:0004713	Function	Protein tyrosine kinase activity	IMP	7537849
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA	21873635
GO:0005009	Function	Insulin-activated receptor activity	IBA	21873635
GO:0005009	Function	Insulin-activated receptor activity	IDA	6849137, 8440175
GO:0005159	Function	Insulin-like growth factor receptor binding	IDA	8452530
GO:0005515	Function	Protein binding	IPI	7493946, 7537849, 7935368, 8452530, 8702689, 8999839, 9506989, 9593725, 9742218, 10500481, 10660596, 11136729, 11163213, 11279102, 11289049, 11374898, 11506178, 11579209, 11796522, 12237455, 12634852, 14568990, 14722096, 15588987, 15629149, 16582879, 16926280, 17092689, 17135270, 171
GO:0005524	Function	ATP binding	IDA	6849137
GO:0005525	Function	GTP binding	IDA	9092559
GO:0005635	Component	Nuclear envelope	IDA	19406747
GO:0005764	Component	Lysosome	IEA
GO:0005770	Component	Late endosome	IEA
GO:0005886	Component	Plasma membrane	IC	6849137
GO:0005886	Component	Plasma membrane	IDA	23137377
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	9092559
GO:0005899	Component	Insulin receptor complex	IBA	21873635
GO:0005899	Component	Insulin receptor complex	IDA	1898103
GO:0005899	Component	Insulin receptor complex	IMP	15069075
GO:0005901	Component	Caveola	IDA	15182363
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0006355	Process	Regulation of transcription, DNA-templated	IMP	12881524
GO:0006468	Process	Protein phosphorylation	TAS	19188609
GO:0006898	Process	Receptor-mediated endocytosis	ISS	19406747
GO:0007169	Process	Transmembrane receptor protein tyrosine kinase signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	9092559
GO:0007275	Process	Multicellular organism development	IBA	21873635
GO:0007612	Process	Learning	TAS	19188609
GO:0007613	Process	Memory	TAS	19188609
GO:0008284	Process	Positive regulation of cell population proliferation	IC	11500939
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	17925406
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	12138094
GO:0008286	Process	Insulin receptor signaling pathway	IDA	6849137, 8440175, 20455999
GO:0008286	Process	Insulin receptor signaling pathway	ISS	19406747
GO:0008286	Process	Insulin receptor signaling pathway	TAS
GO:0009897	Component	External side of plasma membrane	ISS
GO:0010008	Component	Endosome membrane	TAS
GO:0014068	Process	Positive regulation of phosphatidylinositol 3-kinase signaling	IBA	21873635
GO:0016020	Component	Membrane	IDA	8452530
GO:0018108	Process	Peptidyl-tyrosine phosphorylation	IDA	8496180
GO:0019087	Process	Transformation of host cell by virus	IMP	17001305
GO:0019904	Function	Protein domain specific binding	IPI	16246733
GO:0030335	Process	Positive regulation of cell migration	IMP	12138094
GO:0030424	Component	Axon	IBA	21873635
GO:0031981	Component	Nuclear lumen	IDA	19406747
GO:0031994	Function	Insulin-like growth factor I binding	IPI	8452530
GO:0031995	Function	Insulin-like growth factor II binding	IPI	12138094
GO:0032147	Process	Activation of protein kinase activity	IMP	9819385
GO:0032148	Process	Activation of protein kinase B activity	IDA	7556070
GO:0032590	Component	Dendrite membrane	ISS
GO:0032809	Component	Neuronal cell body membrane	ISS
GO:0032869	Process	Cellular response to insulin stimulus	IDA	8440175
GO:0033674	Process	Positive regulation of kinase activity	IBA	21873635
GO:0038024	Function	Cargo receptor activity	ISS	19406747
GO:0042593	Process	Glucose homeostasis	IBA	21873635
GO:0042593	Process	Glucose homeostasis	IMP	7693131
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043243	Process	Positive regulation of protein-containing complex disassembly	ISS	19406747
GO:0043410	Process	Positive regulation of MAPK cascade	IBA	21873635
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	20455999
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	11500939
GO:0043548	Function	Phosphatidylinositol 3-kinase binding	IPI	7537849, 8276809
GO:0043559	Function	Insulin binding	IDA	8440175
GO:0043559	Function	Insulin binding	IPI	8452530
GO:0043560	Function	Insulin receptor substrate binding	IBA	21873635
GO:0043560	Function	Insulin receptor substrate binding	IPI	7493946, 7537849, 7559478
GO:0044877	Function	Protein-containing complex binding	IPI	19406747
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IMP	10747347
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IDA	17925406
GO:0045821	Process	Positive regulation of glycolytic process	IMP	7693131
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	11500939
GO:0045995	Process	Regulation of embryonic development	IMP	7693131
GO:0046326	Process	Positive regulation of glucose import	IDA	3518947
GO:0046326	Process	Positive regulation of glucose import	NAS	11001060
GO:0046777	Process	Protein autophosphorylation	IDA	6849137, 8496180
GO:0046777	Process	Protein autophosphorylation	IMP	7537849
GO:0048639	Process	Positive regulation of developmental growth	IMP	7693131
GO:0051425	Function	PTB domain binding	IPI	7559478
GO:0051897	Process	Positive regulation of protein kinase B signaling	IBA	21873635
GO:0051897	Process	Positive regulation of protein kinase B signaling	IMP	11500939
GO:0060267	Process	Positive regulation of respiratory burst	IDA	9092559
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0097062	Process	Dendritic spine maintenance	ISS	19406747
GO:0097242	Process	Amyloid-beta clearance	ISS	19406747
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1990535	Process	Neuron projection maintenance	ISS

MIM	HGNC	e!Ensembl
147670	6091	ENSG00000171105

Protein

UniProt ID

P06213

Protein name

Insulin receptor (IR) (EC 2.7.10.1) (CD antigen CD220) [Cleaved into: Insulin receptor subunit alpha; Insulin receptor subunit beta]

Protein function

Receptor tyrosine kinase which mediates the pleiotropic actions of insulin. Binding of insulin leads to phosphorylation of several intracellular substrates, including, insulin receptor substrates (IRS1, 2, 3, 4), SHC, GAB1, CBL and other signali

PDB

1GAG , 1I44 , 1IR3 , 1IRK , 1P14 , 1RQQ , 2AUH , 2B4S , 2HR7 , 2MFR , 2Z8C , 3BU3 , 3BU5 , 3BU6 , 3EKK , 3EKN , 3ETA , 3W11 , 3W12 , 3W13 , 4IBM , 4OGA , 4XLV , 4XSS , 4XST , 4ZXB , 5E1S , 5HHW , 5J3H , 5KQV , 5U1M , 6HN4 , 6HN5 , 6PXV , 6PXW , 6SOF , 6VEP , 6VEQ , 7BW7 , 7BW8 , 7BWA , 7KD6 , 7MQO , 7MQR , 7MQS , 7PG0 , 7PG2 , 7PG3 , 7PG4 , 7PHT , 7QID

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01030	Recep_L_domain	52 → 164	Receptor L domain	Repeat
PF00757	Furin-like	179 → 340	Furin-like cysteine rich region	Domain
PF01030	Recep_L_domain	359 → 473	Receptor L domain	Repeat
PF17870	Insulin_TMD	940 → 987	Insulin receptor trans-membrane segment	Domain
PF07714	PK_Tyr_Ser-Thr	1023 → 1290	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Isoform Long and isoform Short are predominantly expressed in tissue targets of insulin metabolic effects: liver, adipose tissue and skeletal muscle but are also expressed in the peripheral nerve, kidney, pulmonary alveoli, pancreatic

Sequence

MATGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAF
PNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVSR
EKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSN
PS

Sequence length

1382

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Ras signaling pathway Rap1 signaling pathway cGMP-PKG signaling pathway HIF-1 signaling pathway FoxO signaling pathway Phospholipase D signaling pathway Hormone signaling mTOR signaling pathway PI3K-Akt signaling pathway AMPK signaling pathway Longevity regulating pathway Longevity regulating pathway - multiple species Adherens junction Insulin signaling pathway Ovarian steroidogenesis Regulation of lipolysis in adipocytes Type II diabetes mellitus Insulin resistance Non-alcoholic fatty liver disease Aldosterone-regulated sodium reabsorption Alzheimer disease Diabetic cardiomyopathy		PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling IRS activation Signal attenuation Insulin receptor signalling cascade Signaling by Insulin receptor Insulin receptor recycling

Show/Hide Causal Diseases (21)

Disease term	Disease name	dbSNP ID	References
Causal
Alzheimer disease	Familial Alzheimer Disease (FAD), Alzheimer Disease, Late Onset, Alzheimer Disease, Early Onset, Alzheimer`s Disease, Alzheimer`s Disease, Focal Onset	rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039 View all (65 more)	24055495
Brachydactyly	Brachydactyly	rs121908949, rs28937580, rs121909082, rs104894122, rs863223289, rs863223290, rs104894121, rs1587657302, rs863223292, rs74315386, rs74315387, rs28936397, rs753691079, rs121909348, rs121917852 View all (22 more)
Cholestasis	Cholestasis	rs121909103, rs751511532, rs376368459, rs762702807, rs1578490102, rs1578499691, rs1578504946, rs1317656688, rs199791850, rs1452792080, rs1578491039
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	rs121908602, rs121908604, rs864309713, rs775394591	21433279
Hyperinsulinemic hypoglycemia	Congenital Hyperinsulinism, Hyperinsulinemic hypoglycemia, Hyperinsulinemic Hypoglycemia, Familial, 5	rs137853103, rs2126234459, rs104894237, rs267607196, rs387906407, rs151344623, rs28936370, rs28938469, rs28936371, rs137852671, rs137852672, rs72559723, rs193922400, rs137852676, rs193922402 View all (71 more)	15161766, 8288049
Cryptorchidism	Cryptorchidism	rs121912555, rs104894697, rs104894698, rs398122886
Developmental delay	Global developmental delay	rs28941770, rs199469464, rs281865469, rs143747297, rs398123009, rs587777428, rs786205133, rs606231459, rs797044854, rs797045027, rs864309504, rs878853160, rs886039902, rs886042046, rs886041291 View all (32 more)
Diabetes mellitus	Diabetes Mellitus, Diabetes Mellitus, Non-Insulin-Dependent, Neonatal diabetes mellitus	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	7657032, 1607076, 1470163
Diabetes mellitus with acanthosis nigricans	Diabetes Mellitus, Insulin-Resistant, with Acanthosis Nigricans	rs121913135, rs121913140, rs121913138, rs121913139, rs121913144, rs121913146, rs121913148, rs121913154, rs121913156	1563582, 2544998, 20339196, 2002058, 2365819, 8243830, 8288049, 12107746, 3283938, 8388389, 9175790, 10733238, 2168397, 28765322, 11260230, 12970295, 8314008, 1963473 View all (3 more)
Gastric cancer	Gastric Adenocarcinoma	rs137854571, rs63751108, rs34612342, rs121908383, rs121909144, rs121909775, rs121909219, rs121909223, rs63750871, rs80359530, rs121964873, rs121913530, rs606231203, rs121918505, rs587776802 View all (244 more)
Hyperinsulinism	Hyperinsulinism, Hyperinsulinism due to INSR deficiency	rs387906407, rs151344623, rs121913156, rs137853245, rs80356655, rs104894010, rs104894012, rs104894014, rs104894015, rs137852676, rs587783169, rs72559716, rs541269678, rs151344624, rs797045209 View all (23 more)	10949030, 18411068
Hypothyroidism	Hypothyroidism	rs869320723, rs121908862, rs121908863, rs121908865, rs121908866, rs121908867, rs121908870, rs121908871, rs121908872, rs2140110277, rs121908881, rs121908884, rs121908885, rs786205080, rs1586182912 View all (22 more)	30595370, 27182965
Insulin-resistant diabetes mellitus	Insulin-resistant diabetes mellitus	rs121913142
Leprechaunism syndrome	Donohue Syndrome, Leprechaunism	rs267607184, rs121913137, rs387906538, rs121913141, rs121913145, rs52836744, rs121913152, rs121913153, rs121913155, rs121913158, rs121913159, rs121913160	12023989, 22768670, 8288049, 18411068, 8419945, 8636294, 9299395, 9703342, 28765322, 24498630, 2834824, 2479553, 2365819, 12970295, 9249867 View all (9 more)
Lipodystrophy	Lipodystrophy	rs553668, rs766817317
Microcephaly	Microcephaly	rs397704721, rs267607176, rs267607177, rs397704725, rs267606717, rs267606718, rs199422202, rs121434311, rs199422203, rs199422126, rs387906274, rs121434305, rs199422125, rs199422135, rs189678019 View all (280 more)
Monogenic diabetes	Monogenic diabetes	rs137852673, rs137853334, rs137853335, rs137853336, rs1600731198, rs137853338, rs587776825, rs137853236, rs137853237, rs137853238, rs2135818776, rs1566092470, rs137853243, rs137853244, rs137853245 View all (194 more)
Parkinson disease	Parkinson Disease	rs33939927, rs35801418, rs34805604, rs35870237, rs34995376, rs74315355, rs28940284, rs74315356, rs74315357, rs28940285, rs730880302, rs750664040, rs74315359, rs74315360, rs45539432 View all (84 more)	19276553
Precocious puberty	Precocious Puberty	rs879255238, rs879255239, rs879255240, rs1264639964, rs1566764505
Rabson-mendenhall syndrome	Rabson-Mendenhall Syndrome, Rabson-Mendenhall syndrome	rs121913143, rs121913144, rs587776819, rs587776820, rs886037750	18411068, 2121734, 10443650, 21869538, 17201797, 8314008, 2365819, 12023989, 8288049, 28765322, 26691667
Renal carcinoma	Renal Cell Carcinoma	rs121913668, rs121913670, rs121913243, rs786202724	28598434

Show/Hide Unknown Diseases (9)

Disease term	Disease name	Source
Unknown
Acanthosis nigricans	Acanthosis Nigricans	ClinVar
Asthma	Asthma	GWAS
Diabetic Retinopathy	Diabetic Retinopathy	GWAS
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWAS
Diabetes	Diabetes	GWAS
Hypertension	Hypertension	GWAS
Gout	Gout	GWAS
Renal Carcinoma	Renal Carcinoma	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS

Show/Hide Text Mining Associations (171)

Disease Name	Relationship Type	References
Associations from Text Mining
Ablepharon macrostomia syndrome	Associate	26637991
Acanthosis Nigricans	Associate	20493471, 31899992
Adenocarcinoma	Stimulate	21952750
Adenocarcinoma	Associate	31211453
Adenoma	Associate	25017244, 39201651
Adenoviridae Infections	Associate	18599527
Adrenocortical Adenoma	Associate	40038716
Adrenocortical Carcinoma	Associate	40038716
AIDS Associated Nephropathy	Associate	22629383
Alcoholism	Associate	18616667
Alzheimer Disease	Associate	22476197, 24731980, 29851783, 30922963, 37264161
Aphasia Conduction	Associate	40065360
Asthma	Associate	32512817
Atherosclerosis	Associate	27729247
Autism Spectrum Disorder	Associate	35165256
Autoimmune Diseases	Associate	1719540
Autoimmune Pancreatitis	Associate	28151472
Barrett Esophagus	Associate	35654816
Bipolar Disorder	Associate	35165256
Blood Coagulation Disorders	Associate	25042561
Brain Ischemia	Associate	32651463
Breast Neoplasms	Associate	16491398, 17043687, 17348446, 21913804, 22046260, 22128190, 22551578, 26077721, 26324738, 26406954, 26896340, 27415018, 28030849, 28038446, 28591735 View all (11 more)
Breast Neoplasms	Inhibit	17348446
Breast Neoplasms	Stimulate	29114882
Burns	Inhibit	22241293
Carcinogenesis	Associate	37873683
Carcinoma	Associate	37185612
Carcinoma Hepatocellular	Associate	10764799, 12918099, 2469133, 26756219, 27514687, 36031387
Carcinoma Lobular	Associate	29669935
Carcinoma Non Small Cell Lung	Associate	21952750, 23826179, 24485233, 24571613, 31053597
Carcinoma Pancreatic Ductal	Associate	34202040
Carcinoma Renal Cell	Associate	24954312, 30852945, 32716909, 34545095
Cardiomyopathy Dilated	Associate	37967988
Carnitine Palmitoyltransferase II Deficiency Infantile	Associate	37974153
Cataract congenital dominant non nuclear	Associate	33206859
Celiac Disease	Associate	26123480
Central Nervous System Neoplasms	Associate	17506723
Chronic Periodontitis	Associate	35676670
Cognition Disorders	Stimulate	22629383
Colorectal Neoplasms	Associate	24175768, 24484717, 25342389, 25557790, 26077721, 27138191, 31666286, 34083590, 37475862
Congenital Hyperinsulinism	Associate	25404386, 25753915, 31989990, 37974153
Craniosynostoses	Associate	19720790
Dementia Vascular	Stimulate	19638714
Depressive Disorder Major	Associate	32536688
Diabetes Complications	Associate	31588494
Diabetes Gestational	Associate	21515851, 26921319, 33776919, 34969688
Diabetes Mellitus	Associate	11887975, 14551916, 15114529, 1602013, 18599527, 2002058, 20339196, 21913804, 2211678, 24289561, 2573522, 26921319, 27125830, 27138191, 28034763 View all (14 more)
Diabetes Mellitus	Stimulate	25825816
Diabetes Mellitus	Inhibit	34831154
Diabetes Mellitus Transient Neonatal 1	Associate	37897565, 38408297
Diabetes Mellitus Type 1	Associate	2573522, 33761612, 33776919, 35742925
Diabetes Mellitus Type 2	Associate	15166380, 1602013, 16127220, 1711209, 1918382, 25867326, 27138191, 2888698, 28934129, 29754174, 31714576, 33801830, 34784930, 34875679, 35742925 View all (6 more)
Diabetes Mellitus Type 2	Stimulate	36018759
Diabetic Cardiomyopathies	Associate	37986298
Diabetic Nephropathies	Associate	25867326, 35721731
Disruptive Impulse Control and Conduct Disorders	Associate	30922963
Donohue Syndrome	Associate	18302477, 20033851, 20339196, 22563226, 22972224, 2300553, 2365819, 25153212, 26871809, 27840822, 2808704, 28663160, 29082893, 31677333, 3280314 View all (9 more)
Donohue Syndrome	Inhibit	25811318
Drug Resistant Epilepsy	Associate	28388656
Dykes Markes Harper syndrome	Associate	37897565
Ectodermal Dysplasia	Associate	37873683
Endometrial Neoplasms	Associate	17233921, 33622671
Epilepsy Temporal Lobe	Associate	25458098
Esophageal Squamous Cell Carcinoma	Associate	36461008
Fatty Liver	Associate	31888241
Fetal Growth Retardation	Associate	19720790, 25472847
Fibrosis	Associate	16962112, 31765403
Frontotemporal Lobar Degeneration	Associate	31081340
Gastro enteropancreatic neuroendocrine tumor	Associate	26836610
Gastrointestinal Stromal Tumors	Associate	24133624
Genetic Diseases Inborn	Associate	21555852, 3014538, 38408297, 6392291
Glioma	Associate	34964902, 35225010
Glucose Intolerance	Inhibit	29168473
Growth Disorders	Associate	19720790, 37897565
Head and Neck Neoplasms	Associate	39619326
Heart Arrest	Stimulate	1334088
Hirsutism	Associate	22972224, 31899992
HIV Infections	Associate	15872228, 22629383
HIV Seropositivity	Associate	22629383
Hyperglycemia	Associate	22266116, 36626508, 8900242
Hyperinsulinism	Associate	20339196, 24484717, 34841688, 7584931, 9240761, 9486982
Hyperinsulinism	Stimulate	26896340
Hyperplasia	Associate	27729247
Hypersensitivity Immediate	Associate	10373457
Hypertension	Associate	7584931, 9240761
Hypertrophy	Associate	22972224
Hypoglycemia	Associate	25753915, 33040071, 35110500
hypoglycemic encephalopathy	Associate	25753915
Infant Newborn Diseases	Associate	31989990
Infertility Male	Associate	25847845
Inflammation	Associate	25516545
Inflammatory Breast Neoplasms	Associate	32423453
Insulin Resistance	Associate	10373457, 10764799, 10819237, 11342531, 11887975, 1315125, 1446650, 15114529, 15380067, 16127220, 17563366, 19164855, 19720790, 2002058, 20339196 View all (60 more)
Insulin Resistance	Stimulate	17986714, 26896340
Insulin Resistance	Inhibit	8550844, 9120013
Kidney Neoplasms	Associate	24954312
Leukemia Lymphocytic Chronic B Cell	Associate	21307146
Leukemia Myeloid Acute	Associate	19789352, 31164492, 34619772
Lipodystrophy	Associate	30657911
Liver Diseases	Associate	40065360
Lung Neoplasms	Associate	28592245
Lymphatic Metastasis	Inhibit	31211453
Lymphatic Metastasis	Associate	31211453
Lymphedema	Associate	38408297
Lymphoma Non Hodgkin	Associate	34964902
Melanoma	Associate	12734206, 6381509
Metabolic Diseases	Associate	32898636
Metabolic Syndrome	Associate	20493471, 22705438, 23515448, 32425888
Migraine Disorders	Associate	15449251
Migraine with Aura	Associate	18455362
Miller McKusick Malvaux Syndrome (3M Syndrome)	Associate	24711643
Mood Disorders	Associate	30391805
Mucolipidosis III Gamma	Associate	37897565
Multiple Myeloma	Associate	23048032
Muscle Neoplasms	Associate	15114529
Muscular Atrophy	Associate	30901379
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	30901379
Myotonic Dystrophy	Associate	15114529, 15546872, 16946708, 17708420, 20339196, 28915272, 30901379, 9120013
Neoplasm Invasiveness	Associate	29114882
Neoplasm Metastasis	Associate	34841688, 35672854, 36387908
Neoplasms	Associate	16207477, 1973037, 21750218, 21751203, 22992069, 23251408, 23974095, 24282611, 24289561, 24484717, 26077721, 26222696, 26263910, 26324738, 26406954 View all (21 more)
Neoplasms	Inhibit	25849721
Neuroblastoma	Associate	24349301
Neurodegenerative Diseases	Associate	36835322
Niemann Pick Disease Type C	Associate	20521171
Non alcoholic Fatty Liver Disease	Inhibit	31888241
Non alcoholic Fatty Liver Disease	Associate	33206859
Obesity	Associate	16127220, 26305227, 26637991, 26976855, 28034763, 31091445, 33761612, 35970449
Oculodental syndrome Rutherfurd syndrome	Associate	22972224
Osteoarthritis	Associate	21324373
Osteosarcoma	Associate	21751203, 23688189
Ovarian Neoplasms	Associate	30786925
Overweight	Stimulate	22278432
Pancreatic Neoplasms	Associate	20630061, 28360038, 33213062
Periodontitis	Associate	35676670
Plaque Atherosclerotic	Associate	22341865
Pleuropulmonary blastoma	Associate	33637876
Polycystic Ovary Syndrome	Associate	10411917, 12477518, 16798275, 17658524, 20493471, 21300347, 21824047, 25303487, 25310961, 26305227, 32425888, 33682741, 33728347, 36139396, 40105555, 7635975, 7920895 View all (2 more)
Prediabetic State	Associate	31882596
Prostatic Hyperplasia	Associate	29129118
Prostatic Neoplasms	Inhibit	21983635
Prostatic Neoplasms	Associate	23251408, 30165429
Prostatitis	Associate	16207477, 21960694, 23251408, 26077721
Pseudoacromegaly with Severe Insulin Resistance	Associate	38408297
Psychotic Disorders	Associate	30391805, 40430072
Pulmonary Disease Chronic Obstructive	Associate	35676670
Purpura Thrombocytopenic Idiopathic	Associate	36800582
Renal cell carcinoma 1	Associate	2365819
Reproductive Tract Infections	Associate	34784930
Retinal Detachment	Stimulate	16030497
Retinal Diseases	Associate	22266116
Rhabdoid Tumor Predisposition Syndrome 1	Associate	17506723
Schizophrenia	Associate	32898636, 35165256, 36310155, 40430072
Scoliosis	Associate	24155906
Seminoma	Associate	15967097
Smoke Inhalation Injury	Associate	36461008
Squamous Cell Carcinoma of Head and Neck	Associate	35217577
Stomach Neoplasms	Associate	28596683, 30989432, 34554347
Substance Related Disorders	Associate	30922963
Syndrome	Associate	1446650
Thrombophilia	Associate	38225453
Thrombosis	Associate	26921319
Thyroid Cancer Papillary	Associate	30657911
Thyroid Diseases	Associate	30657911
Thyroid Neoplasms	Associate	28703219, 38165228
Thyroiditis	Associate	30657911
Triple Negative Breast Neoplasms	Associate	29099049, 36920947
Vitreoretinopathy Proliferative	Associate	16030497
Warburg Sjo Fledelius syndrome	Associate	22341865
Weight Loss	Associate	26637991
Wolfram Like Syndrome Autosomal Dominant	Associate	38527457

INSR (insulin receptor)