Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3642
Gene name	INSM transcriptional repressor 1
Gene symbol	INSM1
Synonyms (NCBI Gene)	IA-1IA1
Chromosome	20
Chromosome location	20p11.23
Summary	Insulinoma-associated 1 (INSM1) gene is intronless and encodes a protein containing both a zinc finger DNA-binding domain and a putative prohormone domain. This gene is a sensitive marker for neuroendocrine differentiation of human lung tumors. [provided

Show/Hide all (19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001751	hsa-miR-375	Other	15806104
MIRT1067752	hsa-miR-33a	CLIP-seq
MIRT1067753	hsa-miR-33b	CLIP-seq
MIRT1067754	hsa-miR-4311	CLIP-seq
MIRT1067755	hsa-miR-548a-5p	CLIP-seq
MIRT1067756	hsa-miR-548ab	CLIP-seq
MIRT1067757	hsa-miR-548ak	CLIP-seq
MIRT1067758	hsa-miR-548b-5p	CLIP-seq
MIRT1067759	hsa-miR-548c-5p	CLIP-seq
MIRT1067760	hsa-miR-548d-5p	CLIP-seq
MIRT1067761	hsa-miR-548h	CLIP-seq
MIRT1067762	hsa-miR-548i	CLIP-seq
MIRT1067763	hsa-miR-548j	CLIP-seq
MIRT1067764	hsa-miR-548n	CLIP-seq
MIRT1067765	hsa-miR-548t	CLIP-seq
MIRT1067766	hsa-miR-548w	CLIP-seq
MIRT1067767	hsa-miR-548y	CLIP-seq
MIRT1067768	hsa-miR-559	CLIP-seq
MIRT1067754	hsa-miR-4311	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
CREBBP	Activation	17300785
POU1F1	Unknown	8188699

Show/Hide all (56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11842116, 16569215, 18417529, 19124461
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	11842116, 16569215, 18417529
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	16569215
GO:0001933	Process	Negative regulation of protein phosphorylation	IDA	19124461
GO:0003309	Process	Type B pancreatic cell differentiation	IEA
GO:0003309	Process	Type B pancreatic cell differentiation	ISS
GO:0003310	Process	Pancreatic A cell differentiation	IEA
GO:0003310	Process	Pancreatic A cell differentiation	ISS
GO:0003323	Process	Type B pancreatic cell development	IEA
GO:0003358	Process	Noradrenergic neuron development	IEA
GO:0003358	Process	Noradrenergic neuron development	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	11842116, 16569215, 18417529
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0007399	Process	Nervous system development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	19124461
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010468	Process	Regulation of gene expression	ISS
GO:0010564	Process	Regulation of cell cycle process	IBA
GO:0016477	Process	Cell migration	IEA
GO:0017053	Component	Transcription repressor complex	IBA
GO:0017053	Component	Transcription repressor complex	IDA	16569215, 18417529
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0030332	Function	Cyclin binding	IPI	16569215, 18417529, 19124461
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0031018	Process	Endocrine pancreas development	IEA
GO:0031490	Function	Chromatin DNA binding	IDA	16569215, 18417529
GO:0035270	Process	Endocrine system development	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042421	Process	Norepinephrine biosynthetic process	IEA
GO:0042421	Process	Norepinephrine biosynthetic process	ISS
GO:0042826	Function	Histone deacetylase binding	IPI	16569215, 18417529
GO:0043254	Process	Regulation of protein-containing complex assembly	IDA	19124461
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045597	Process	Positive regulation of cell differentiation	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	19124461
GO:0060090	Function	Molecular adaptor activity	EXP	23721412
GO:0060290	Process	Transdifferentiation	IDA	16511571
GO:0061104	Process	Adrenal chromaffin cell differentiation	IEA
GO:0061104	Process	Adrenal chromaffin cell differentiation	ISS
GO:0061549	Process	Sympathetic ganglion development	IEA
GO:0061549	Process	Sympathetic ganglion development	ISS
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	ISS

MIM	HGNC	e!Ensembl
600010	6090	ENSG00000173404

Q01101

Protein name

Insulinoma-associated protein 1 (Zinc finger protein IA-1)

Protein function

Sequence-specific DNA-binding transcriptional regulator that plays a key role in neurogenesis and neuroendocrine cell differentiation during embryonic and/or fetal development. Binds to the consensus sequence 5'-[TG][TC][TC][TT][GA]GGG[CG]A-3' i

PDB

2LV2 , 3ZMS , 8JPY , 8JQ1 , 8K81

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	295 → 317	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	367 → 390	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	440 → 464	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	469 → 492	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in pancreatic duct cells. Expressed in several tumor cell lines of neuroendocrine origin including pheochromocytoma, medullary thyroid carcinoma, insulinoma, medulloblastoma, retinoblastoma, pheochromacytoma, medullary thyroi

Sequence

MPRGFLVKRSKKSTPVSYRVRGGEDGDRALLLSPSCGGARAEPPAPSPVPGPLPPPPPAE
RAHAALAAALACAPGPQPPPQGPRAAHFGNPEAAHPAPLYSPTRPVSREHEKHKYFERSF
NLGSPVSAESFPTPAALLGGGGGGGASGAGGGGTCGGDPLLFAPAELKMGTAFSAGAEAA
RGPGPGPPLPPAAALRPPGKRPPPPTAAEPPAKAVKAPGAKKPKAIRKLHFEDEVTTSPV
LGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYRCPEC
AKVFSCPANLASHRRWHKPRPAPAAARAPEPEAAARAEAREAPGGGSDRDTPSPGGVSES
GSEDGLYECHHCAKKFRRQAYLRKHLLAHHQALQAKGAPLAPPAEDLLALYPGPDEKAPQ
EAAGDGEGAGVLGLSASAECHLCPVCGESFASKGAQERHLRLLHAAQVFPCKYCPATFYS
SPGLTRHINKCHPSENRQVILLQVPVRPAC

Sequence length

510

Interactions

View interactions

	Reactome
			Regulation of gene expression in endocrine-committed (NEUROG3+) progenitor cells

INSM1 (INSM transcriptional repressor 1)