INSL4 (insulin like 4)

Gene

• Entrez ID: 3641
• Gene name: Insulin like 4
• Gene symbol: INSL4
• Synonyms (NCBI Gene): EPIL, PLACENTIN
• Chromosome: 9
• Chromosome location: 9p24.1
• Summary: INSL4 encodes the insulin-like 4 protein, a member of the insulin superfamily. INSL4 encodes a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030220	hsa-miR-26b-5p	Microarray	19088304
MIRT532329	hsa-miR-8084	PAR-CLIP	22012620
MIRT532328	hsa-miR-580-5p	PAR-CLIP	22012620
MIRT532327	hsa-miR-494-3p	PAR-CLIP	22012620
MIRT532326	hsa-miR-1257	PAR-CLIP	22012620
MIRT443739	hsa-miR-16-1-3p	PAR-CLIP	22100165
MIRT443738	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT443737	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443736	hsa-miR-550b-2-5p	PAR-CLIP	22100165
MIRT443735	hsa-miR-2113	PAR-CLIP	22100165
MIRT532329	hsa-miR-8084	PAR-CLIP	22012620
MIRT532328	hsa-miR-580-5p	PAR-CLIP	22012620
MIRT532327	hsa-miR-494-3p	PAR-CLIP	22012620
MIRT532326	hsa-miR-1257	PAR-CLIP	22012620
MIRT443739	hsa-miR-16-1-3p	PAR-CLIP	22100165
MIRT443738	hsa-miR-1227-3p	PAR-CLIP	22100165
MIRT443737	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT443736	hsa-miR-550b-2-5p	PAR-CLIP	22100165
MIRT443735	hsa-miR-2113	PAR-CLIP	22100165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	TAS	8702754
GO:0005159	Function	Insulin-like growth factor receptor binding	TAS	8666396
GO:0005179	Function	Hormone activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	TAS	8702754
GO:0007165	Process	Signal transduction	IEA
GO:0007267	Process	Cell-cell signaling	TAS	8702754
GO:1901384	Process	Positive regulation of chorionic trophoblast cell proliferation	TAS	8702754

Other IDs

• MIM: 600910
• HGNC: 6087
• e!Ensembl: ENSG00000120211

Protein

• UniProt ID: Q14641
• Protein name: Early placenta insulin-like peptide (EPIL) (Insulin-like peptide 4) (Placentin) [Cleaved into: Early placenta insulin-like peptide B chain; Early placenta insulin-like peptide A chain]
• Protein function: May play an important role in trophoblast development and in the regulation of bone formation.
• Tissue specificity: TISSUE SPECIFICITY: Expressed in placenta, uterus and in fetal perichondrium. Expression levels were increased in both early placentas and molar pregnancies and were reduced in choriocarcinoma cells. {ECO:0000269|PubMed:12414911, ECO:0000269|PubMed:974031
• Sequence:

  MASLFRSYLPAIWLLLSQLLRESLAAELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLE
  SGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRF
  DPFCCEVICDDGTSVKLCT

• Sequence length: 139

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CLONAL HEMATOPOIESIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Adenocarcinoma of Lung	Associate	34612148	★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Associate	15958731	★☆☆☆☆ Found in Text Mining only
Fetal Growth Retardation	Inhibit	37661175	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	36326314	★☆☆☆☆ Found in Text Mining only