INS (insulin)

Gene

• Entrez ID: 3630
• Gene name: Insulin
• Gene symbol: INS
• Synonyms (NCBI Gene): IDDM, IDDM1, IDDM2, ILPR, IRDN, MODY10, PNDM4
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene encodes insulin, a peptide hormone that plays a vital role in the regulation of carbohydrate and lipid metabolism. After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT440450	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440449	hsa-miR-544a	HITS-CLIP	24374217
MIRT440448	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT440449	hsa-miR-544a	HITS-CLIP	24374217
MIRT440448	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT440450	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440449	hsa-miR-544a	HITS-CLIP	24374217
MIRT440448	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT440449	hsa-miR-544a	HITS-CLIP	24374217
MIRT440448	hsa-miR-412-3p	HITS-CLIP	24374217
MIRT735403	hsa-miR-24-3p	qRT-PCR	32226248

Transcription factors

Transcription factor	Regulation	Reference
ATF2	Activation	21278380
ATF2	Unknown	10909971
GLIS3	Unknown	23856252
KLF11	Activation	18593768
KLF11	Unknown	15774581;18199129;21592955
MAFA	Unknown	16461554;21830322
NEUROD1	Unknown	10545951;16461554
NR1H4	Activation	20060466
PAX4	Repression	17426099
PAX4	Unknown	10601637
PDX1	Activation	7568086
PDX1	Unknown	10426567;10567373;10585868;20886630
TCF3	Unknown	10567574;9665477

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001819	Process	Positive regulation of cytokine production	IDA	15473891
GO:0002020	Function	Protease binding	IPI	20082125
GO:0002674	Process	Negative regulation of acute inflammatory response	IDA	11443198
GO:0005158	Function	Insulin receptor binding	IBA
GO:0005158	Function	Insulin receptor binding	IDA	7556975, 9667398
GO:0005158	Function	Insulin receptor binding	IPI	8452530
GO:0005159	Function	Insulin-like growth factor receptor binding	IPI	8452530
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IC	9667398
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	IMP	381941
GO:0005179	Function	Hormone activity	NAS	14986111
GO:0005515	Function	Protein binding	IPI	9388210, 9773776, 17051221, 23302862, 29512653, 29764935, 32296183
GO:0005576	Component	Extracellular region	IC	7556975
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9667398
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005796	Component	Golgi lumen	TAS
GO:0006006	Process	Glucose metabolic process	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	12881524
GO:0006953	Process	Acute-phase response	IDA	14739855
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	9092559
GO:0007267	Process	Cell-cell signaling	IC	7556975
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	7688386, 17925406
GO:0008286	Process	Insulin receptor signaling pathway	IDA	8440175, 38056462
GO:0008286	Process	Insulin receptor signaling pathway	IDA	8702995, 15792832, 20455999
GO:0008286	Process	Insulin receptor signaling pathway	IGI	19727662
GO:0008286	Process	Insulin receptor signaling pathway	IMP	14615391
GO:0010628	Process	Positive regulation of gene expression	IGI	25403480
GO:0010629	Process	Negative regulation of gene expression	IDA	31501273
GO:0010750	Process	Positive regulation of nitric oxide mediated signal transduction	IDA	15792832
GO:0010750	Process	Positive regulation of nitric oxide mediated signal transduction	IMP	14615391
GO:0010976	Process	Positive regulation of neuron projection development	IC	36250347
GO:0010976	Process	Positive regulation of neuron projection development	IDA	36250347
GO:0030133	Component	Transport vesicle	TAS
GO:0030307	Process	Positive regulation of cell growth	NAS	11742412
GO:0030335	Process	Positive regulation of cell migration	ISS	12138094
GO:0031904	Component	Endosome lumen	TAS
GO:0032880	Process	Regulation of protein localization	IDA	14615391
GO:0033116	Component	Endoplasmic reticulum-Golgi intermediate compartment membrane	TAS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0038060	Process	Nitric oxide-cGMP-mediated signaling	IDA	14744991
GO:0038202	Process	TORC1 signaling	IDA	12087098
GO:0042060	Process	Wound healing	IDA	9498508
GO:0042177	Process	Negative regulation of protein catabolic process	IDA	15185208
GO:0042311	Process	Vasodilation	IDA	14744991
GO:0042311	Process	Vasodilation	NAS	12946932
GO:0042593	Process	Glucose homeostasis	IBA
GO:0042593	Process	Glucose homeostasis	IMP	381941
GO:0042802	Function	Identical protein binding	IPI	17472440, 20738396, 22854022, 23106816, 23416304, 23510797
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	19727662
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	11500939, 20455999
GO:0045597	Process	Positive regulation of cell differentiation	NAS	11742412
GO:0045721	Process	Negative regulation of gluconeogenesis	NAS	11742412
GO:0045725	Process	Positive regulation of glycogen biosynthetic process	IDA	17925406
GO:0045727	Process	Positive regulation of translation	IMP	28106072
GO:0045818	Process	Negative regulation of glycogen catabolic process	IMP	381941
GO:0045821	Process	Positive regulation of glycolytic process	IDA	7688386
GO:0045821	Process	Positive regulation of glycolytic process	IMP	381941
GO:0045840	Process	Positive regulation of mitotic nuclear division	IDA	10644978, 11500939
GO:0045922	Process	Negative regulation of fatty acid metabolic process	IMP	1184755
GO:0046326	Process	Positive regulation of D-glucose import	IDA	14615391, 15792832
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IDA	7688386
GO:0046631	Process	Alpha-beta T cell activation	IDA	10604997
GO:0046889	Process	Positive regulation of lipid biosynthetic process	NAS	11742412
GO:0048018	Function	Receptor ligand activity	IDA	8702995
GO:0048167	Process	Regulation of synaptic plasticity	TAS	19188609
GO:0050708	Process	Regulation of protein secretion	IDA	15591776
GO:0050709	Process	Negative regulation of protein secretion	IDA	14739855
GO:0050714	Process	Positive regulation of protein secretion	IBA
GO:0050890	Process	Cognition	TAS	19188609
GO:0050995	Process	Negative regulation of lipid catabolic process	IMP	24675707
GO:0050995	Process	Negative regulation of lipid catabolic process	NAS	11742412
GO:0051000	Process	Positive regulation of nitric-oxide synthase activity	NAS	12135947
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	7688386, 8702995, 11500939, 25240198
GO:0055089	Process	Fatty acid homeostasis	IMP	1184755
GO:0060266	Process	Negative regulation of respiratory burst involved in inflammatory response	IDA	11443198
GO:0060267	Process	Positive regulation of respiratory burst	IDA	9092559
GO:0090277	Process	Positive regulation of peptide hormone secretion	TAS	11387233
GO:0090336	Process	Positive regulation of brown fat cell differentiation	TAS	11387233
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	20455999
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	TAS	19188609
GO:1901701	Process	Cellular response to oxygen-containing compound	IEA
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	NAS	16604263
GO:1902952	Process	Positive regulation of dendritic spine maintenance	IGI	19188609
GO:1903076	Process	Regulation of protein localization to plasma membrane	IGI	19188609
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	IGI	19188609
GO:1990535	Process	Neuron projection maintenance	IGI	19188609
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	39032648
GO:2000252	Process	Negative regulation of feeding behavior	IDA	17957153

Other IDs

• MIM: 176730
• HGNC: 6081
• e!Ensembl: ENSG00000254647

Protein

• UniProt ID: P01308
• Protein name: Insulin [Cleaved into: Insulin B chain; Insulin A chain]
• Protein function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
• PDB: 1A7F, 1AI0, 1AIY, 1B9E, 1BEN, 1EFE, 1EV3, 1EV6, 1EVR, 1FU2, 1FUB, 1G7A, 1G7B, 1GUJ, 1HIQ, 1HIS, 1HIT, 1HLS, 1HTV, 1HUI, 1IOG, 1IOH, 1J73, 1JCA, 1JCO, 1JK8, 1K3M, 1KMF, 1LKQ, 1LPH, 1MHI, 1MHJ, 1MSO, 1OS3, 1OS4, 1Q4V, 1QIY, 1QIZ, 1QJ0, 1RWE, 1SF1, 1SJT, 1SJU, 1T0C, 1T1K, 1T1P, 1T1Q, 1TRZ, 1TYL, 1TYM, 1UZ9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00049	Insulin	28 → 109	Insulin/IGF/Relaxin family	Domain

• Sequence:

  MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
  LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

• Sequence length: 110

Pathways

KEGG:

MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
Hormone signaling
Oocyte meiosis
Autophagy - animal
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Regulation of actin cytoskeleton
Insulin signaling pathway
Insulin secretion
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Regulation of lipolysis in adipocytes
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease
Type I diabetes mellitus
Maturity onset diabetes of the young
Aldosterone-regulated sodium reabsorption
Alzheimer disease
Prostate cancer
Diabetic cardiomyopathy

Reactome:

Insulin processing
Synthesis, secretion, and deacylation of Ghrelin
COPI-mediated anterograde transport
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
IRS activation
Signal attenuation
Insulin receptor signalling cascade
Signaling by Insulin receptor
Insulin receptor recycling
FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes
Amyloid fiber formation

<

Associated diseases

Causal
Disease merge term	Disease name	dbSNP ID	References
Diabetes Mellitus	permanent neonatal diabetes mellitus, Diabetes mellitus, permanent neonatal 4, diabetes mellitus, neonatal diabetes mellitus	rs748749585, rs80356669, rs80356663, rs397515519	N/A
Hyperproinsulinemia	hyperproinsulinemia	rs148685531, rs80356668, rs28933985	N/A

Unknown
Disease merge term	Disease name	Evidence	References	Source
Cervical Cancer	Cervical cancer	N/A	N/A	GWAS
Diabetes	Type 1 diabetes	N/A	N/A	GWAS
Diabetes	Type 2 diabetes, Latent autoimmune diabetes vs. type 2 diabetes, Severe autoimmune type 2 diabetes, maturity-onset diabetes of the young type 10, maturity-onset diabetes of the young	N/A	N/A	GWAS, GenCC
Mason type diabetes	maturity onset diabetes mellitus in young	N/A	N/A	ClinVar
Monogenic Diabetes	monogenic diabetes	N/A	N/A	GenCC, ClinVar

Associations from Text Mining
Disease Name	Relationship Type	References
3C syndrome	Inhibit	40244011
6q24 Related Transient Neonatal Diabetes Mellitus	Inhibit	24827651
AA amyloidosis	Associate	21115952, 33767265, 35595809, 9560308
AA amyloidosis	Inhibit	24654599
Abnormalities Drug Induced	Associate	12507914
Abortion Habitual	Inhibit	21517693
Acanthosis Nigricans	Associate	29430577
Acidosis Lactic	Associate	31630688
Acidosis Lactic	Stimulate	34419042
Acne Vulgaris	Associate	38009017
Acromegaly	Stimulate	26087292, 33019423
Acromegaly	Associate	34929488
Adenocarcinoma	Associate	20182859, 31211453
Adenoma	Associate	25017244
Adenoma Islet Cell	Associate	23423694, 24703313, 26666605, 31728565, 37581620
Adenoma Islet Cell	Inhibit	28900071
Adrenal Gland Neoplasms	Associate	1702931
Adrenal Insufficiency	Associate	38360088
Adrenocortical Carcinoma	Associate	1702931
Aging Premature	Associate	36060975
Albuminuria	Associate	31912623
Alcoholism	Associate	18616667
Alcoholism	Stimulate	23462698
Alzheimer Disease	Associate	12185156, 12507914, 17613531, 18430999, 18612998, 19625744, 20405009, 21115952, 21411544, 22235132, 22297646, 22476197, 22571978, 22982105, 24088404, 24196233, 24265728, 24346217, 26010513, 26214150, 26297026, 27079723, 28050343, 28105773, 28230058, 28550261, 28922161, 29154275, 29945658, 30056117, 30768625, 30775986, 31081340, 31270305, 31635074, 33865867, 35165256, 35253743, 35974022, 35996309, 36070700, 36744339, 37108578, 9366728
Alzheimer Disease	Inhibit	23507773, 26036653, 26444783, 30383799
Anemia	Inhibit	35021220
Angina Pectoris	Associate	31508506
Anhedonia	Associate	32198016
Aniridia	Associate	30334364
Anorexia	Associate	32920595
Anorexia Nervosa	Associate	17705672, 35165256
Anorexia Nervosa	Inhibit	32920595
Anovulation	Inhibit	25595199
Anxiety	Stimulate	15139733
Arthritis Infectious	Associate	19262007
Arthritis Juvenile	Associate	36403012
Asthma	Associate	25642424, 28599074
Ataxia Telangiectasia	Associate	26606753
Atherosclerosis	Associate	11443108, 22525426, 23811853, 29430577, 34051802, 35129650, 9081122
Atrophy	Inhibit	15100091
Atrophy	Associate	22265870
Attention Deficit and Disruptive Behavior Disorders	Associate	36674557
Attention Deficit Disorder with Hyperactivity	Associate	35165256
Atypical Hemolytic Uremic Syndrome	Associate	32950058
Autism Spectrum Disorder	Associate	35165256, 36862688
Autistic Disorder	Associate	31347308
Autoimmune Diseases	Associate	1719540, 20876716, 27048654, 30979797
Autoimmune Diseases	Inhibit	19912253
Barrett Esophagus	Associate	34684639
Beckwith Wiedemann Syndrome	Associate	2565083, 28102591, 33300436
beta Thalassemia	Associate	19351735, 29175121
Bile Duct Neoplasms	Associate	18375961
Biliary Tract Neoplasms	Associate	18375961
Bipolar Disorder	Associate	35165256
Birth Weight	Associate	38421160
Blood Coagulation Disorders	Associate	18614853
Blood Platelet Disorders	Stimulate	17127486
Blood Platelet Disorders	Associate	22688337
Blood Platelet Disorders	Inhibit	24584741
Body Weight	Associate	23839870
Bone Diseases	Associate	21995288
Brain Damage Chronic	Associate	33762279
Brain Diseases	Associate	23028511, 31630688
Brain Injuries Traumatic	Associate	24332562
Brain Ischemia	Inhibit	28263224
Brain Neoplasms	Associate	17506723
Breast Neoplasms	Associate	1070004, 15922332, 16491398, 19865540, 20068169, 21437235, 2174437, 23877285, 24131755, 24422628, 25701261, 26281834, 27364358, 27415018, 28038446, 28631569, 29486734, 30092829, 30229539, 30277539, 30936085, 31480557, 31771180, 31958132, 32631390, 32733384, 34456877, 34841688, 35082309, 35403707, 35580079, 35672854, 37004031, 37461077, 38036052, 698040, 8286193, 9545345
Breast Neoplasms	Stimulate	27388232, 28427228, 31292496
Bronchopulmonary Dysplasia	Associate	31876736
Cachexia	Associate	18704987, 37014770
Calcinosis	Stimulate	17056676
Calcinosis Cutis	Associate	12950263
Calculi	Associate	18375961
Camptodactyly 1	Inhibit	39515123
Carcinogenesis	Associate	27125830, 27842582, 28592245
Carcinoma Hepatocellular	Associate	11390373, 12606056, 12918099, 21464041, 2469133, 2475498, 24895527, 25945652, 26756219, 27514687, 2878937, 29414761, 3040466, 32210717, 36156098, 36773462, 37328795, 39344752, 7562058, 8864852
Carcinoma Hepatocellular	Inhibit	7683658
Carcinoma Pancreatic Ductal	Associate	19571666, 19878864, 23159620, 28521289, 34061869, 34202040, 39231457, 40443651
Carcinoma Pancreatic Ductal	Inhibit	40244011
Carcinoma Renal Cell	Associate	30605491
Cardiomyopathy Dilated	Inhibit	28600985
Cardiomyopathy Restrictive	Associate	25702040, 35912794
Cardiomyopathy Restrictive	Stimulate	26100928
Cardiovascular Diseases	Associate	14647894, 16418168, 17351274, 19455304, 21951953, 22185674, 22468791, 27133621, 28219664, 29893513, 30857250, 32150081, 37329449, 38268038
Cardiovascular Diseases	Inhibit	32406318
Cartilage Diseases	Inhibit	26549531
Cataract	Associate	17149363
Cell Transformation Neoplastic	Associate	34841688
Central Cord Syndrome	Associate	35843386
Central Nervous System Neoplasms	Associate	17506723
Cerebellar Hypoplasia	Associate	18478238
Chemical and Drug Induced Liver Injury	Associate	29749571
Cholangitis Sclerosing	Associate	35260800
Cholelithiasis	Associate	3537011
Chondrosarcoma	Stimulate	26181853
Chronic Kidney Disease Mineral and Bone Disorder	Associate	36329547
Chronobiology Disorders	Associate	36060975
Clinical Deterioration	Associate	18411240
Cognition Disorders	Associate	18612998, 21951953, 24660790, 26134514, 28050343, 29945658, 30965038
Cognitive Dysfunction	Associate	17661009, 18612998, 30775986, 35076713, 36744339
Cognitive Dysfunction	Stimulate	18430999, 22571978
Cognitive Dysfunction	Inhibit	23507773
Colitis Ulcerative	Associate	35260800
Colonic Neoplasms	Associate	12007784, 27273097
Colorectal Neoplasms	Associate	18478343, 19773552, 20622004, 21999454, 22354904, 22554284, 22558377, 23877285, 24175768, 24184209, 24441198, 25557790, 28268248, 29793481, 30649085, 30726946
Colorectal Neoplasms	Inhibit	27842582
Colorectal Neoplasms	Stimulate	35048991
Coma	Stimulate	22977253
Congenital Abnormalities	Inhibit	21517693
Congenital Abnormalities	Associate	34035238
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Associate	34153873
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	22584727, 28341696, 32182220
Congenital Hyperinsulinism	Associate	11228046, 11395395, 12588953, 12621037, 16899796, 18285554, 19417036, 19720803, 20019678, 20357370, 21536946, 21836102, 21968111, 23266803, 23563683, 23869231, 24584741, 26339388, 26799617, 28102591, 28532504, 28600547, 29901727, 31218401, 31371265, 31577849, 32027664, 33679602, 33762279, 33910593, 34497584, 36239000, 37974153, 38033998, 7847376, 8751851, 9280302, 9312191, 9769320
Congenital Hyperinsulinism	Inhibit	17184146, 36876056
Congenital Hyperinsulinism	Stimulate	21968108, 30261196, 34380013
Corneal Diseases	Associate	15037573
Corneal Endothelial Cell Loss	Associate	31835296, 33967958
Coronary Artery Disease	Associate	12850828, 17351274, 17551966, 24489861, 26253791, 31835296, 35260800
Coronary Artery Disease	Stimulate	25696117
Coronary Disease	Associate	21633404
COVID 19	Inhibit	35343389
COVID 19	Associate	36232381
Critical Illness	Associate	16075063, 18052686, 22018099
Critical Illness	Inhibit	18056792
Crohn Disease	Associate	35260800
Cushing Syndrome	Associate	36316863
Cystic Fibrosis	Associate	23952705, 26547591, 29249670, 29434062, 31697830, 32433667, 33586024, 34836301, 37503734, 6345593
Cytokine Release Syndrome	Associate	26247670
Cytokine Release Syndrome	Inhibit	35040554
Deafness	Associate	27966441, 8121460
Delayed Cranial Ossification due to CBFB Haploinsufficiency	Associate	36107630
Dementia	Associate	27079723, 37420130, 37778510
Dementia	Stimulate	30768625
Dementia Vascular	Associate	22571978
Depressive Disorder	Stimulate	19346733
Depressive Disorder	Associate	20161799, 27447786, 30308579, 30965038, 35165256
Diabetes Complications	Associate	27802092
Diabetes Complications	Inhibit	32847960, 36701305
Diabetes Gestational	Inhibit	11832353, 20948967, 22808198, 24606082, 26494027, 26710791, 27406815, 28503212, 29959933, 30477160, 32993411, 33767671, 40147358
Diabetes Gestational	Associate	17317761, 21515851, 22308218, 22893718, 23209187, 24030069, 24665145, 25512553, 26584065, 26710791, 26921319, 27981520, 28360945, 28919328, 30257980, 30919529, 30953560, 31969632, 31978117, 32079298, 32144130, 32365792, 32407388, 33232364, 33859622, 34518156, 34763465, 34989285, 35449053, 35613088, 35893051, 35926094, 39408904, 39684804
Diabetes Gestational	Stimulate	27736899, 31542245, 37264354, 40004118
Diabetes Mellitus	Associate	10810087, 11070077, 11238556, 12028454, 12118200, 12145235, 12226552, 12537604, 12952878, 1353534, 13967777, 14647894, 15010337, 15037573, 15046555, 15932520, 1601997, 16276008, 16467597, 16814735, 16864906, 17056676, 17137336, 17613531, 17855560, 17903298, 18084116, 18176722, 18271689, 18451997, 18567820, 18647954, 18719643, 18802479, 18840770, 1899928, 19008344, 19020324, 19121768, 19121992, 19183934, 19296077, 19571666, 19656320, 19741193, 20007936, 2002494, 2002627, 20056952, 20106974, 20133622, 20185809, 20339196, 20368233, 20462406, 20522167, 20522590, 20547533, 20548773, 20948967, 21137020, 21336277, 21349175, 21669045, 21713316, 21814547, 21865331, 21871827, 21904299, 21953423, 22033917, 22164267, 22185674, 22476197, 22525426, 22558111, 22584727, 22815030, 23308243, 23350652, 23423694, 23462698, 23551881, 23759396, 23826383, 23952705, 24030943, 24083371, 24324748, 24441198, 24521217, 24671046, 25002580, 25086207, 25157406, 25213455, 25370850, 25524915, 25562486, 25562888, 25618333, 25641314, 26101329, 26103160, 26193220, 26202599, 26273670, 26418361, 26426397, 26525881, 26530398, 26615044, 26887289, 26948978, 27177031, 27399229, 27401534, 27466884, 27535125, 27720726, 27966441, 27981520, 27998387, 28034763, 28111849, 28254226, 28271591, 28272210, 28410371, 28521289, 28542303, 28594910, 28607108, 28712214, 28757432, 28758130, 28789618, 28919328, 29034901, 29081341, 2908729, 29157981, 29246973, 29256855, 29401509, 29486734, 29712868, 30092829, 30251567, 30276744, 30414308, 30503261, 30533028, 30774850, 30931946, 30969375, 3113537, 31176671, 31196892, 31234367, 31362984, 31499737, 31605659, 31676859, 31882596, 31988329, 32001615, 32059761, 32077075, 32098630, 32182220, 32345350, 32361463, 32460030, 3280182, 32814719, 33145960, 33198821, 33345910, 3339124, 33446570, 33551986, 33759360, 33767265, 33776919, 34153873, 34245311, 34257700, 34290145, 34352411, 34354158, 34380694, 34415483, 34600296, 34609028, 34792267, 34850014, 34952193, 35069438, 35077398, 35247066, 35260800, 35297680, 35299958, 35299972, 3537011, 35504843, 35518939, 35595809, 35651332, 35665752, 35742925, 35803018, 35855056, 35955956, 35956419, 35963866, 36150054, 36251483, 36280617, 36313763, 36329547, 36368478, 36418577, 36496541, 36529747, 36749274, 36749929, 36768715, 36815184, 36964318, 37123136, 37158952, 3722372, 37280435, 37288664, 37365285, 37453421, 37512131, 38032738, 38061968, 38172847, 38213994, 38304198, 38360088, 3921105, 39461404, 40026692, 4024089, 40305339, 6171128, 6312455, 6340470, 6419838, 6424111, 6759208, 7858104, 8121460, 8325892, 8416266, 8421693, 8755631, 8941652, 8981925, 9078243, 9081122, 908763, 9120002, 9218523, 9617861, 9625453, 9844045, 9845654, 990715
Diabetes Mellitus	Inhibit	12037147, 15654602, 17417692, 18556337, 20153489, 20724797, 21517693, 22332874, 23762265, 24131755, 25642774, 26965843, 27759896, 28436541, 28758947, 29131315, 29546061, 30383799, 31012517, 31196892, 31256036, 31740700, 31756165, 33250457, 33767671, 34083567, 34420950, 34654408, 34890117, 34937509, 35222269, 35498407, 35784546, 36422510, 37251668, 39515123, 40244011, 40420722
Diabetes Mellitus	Stimulate	27133621, 31630688, 38250713
Diabetes Mellitus Congenital Autoimmune	Associate	35010780
Diabetes Mellitus Insulin Dependent 19	Associate	20005362
Diabetes Mellitus Insulin Dependent 19	Stimulate	25644968
Diabetes Mellitus Neonatal with Congenital Hypothyroidism	Associate	20007936
Diabetes Mellitus Permanent Neonatal	Inhibit	15115830, 21273495, 22672870, 27033559
Diabetes Mellitus Permanent Neonatal	Associate	18162506, 18451997, 20220270, 20226046, 23050777, 23350652, 24138066, 30503261, 31908791, 36414599, 36686471
Diabetes Mellitus Transient Neonatal 1	Inhibit	15115830, 23223019, 23456528, 25015100, 35612844
Diabetes Mellitus Transient Neonatal 1	Associate	16268330, 17855560, 18162506, 20133622, 25497100, 26530398, 28083968, 29624227, 31605659, 31908791, 35069438, 36686471, 38360088
Diabetes Mellitus Type 1	Associate	10433097, 10775523, 10893317, 11070077, 11238556, 11507694, 11598829, 11790888, 11872691, 12606056, 1353534, 1370298, 14639528, 15115311, 15303408, 15314696, 15543206, 15889096, 15914531, 15932520, 16260488, 16276008, 16519819, 16570164, 16864906, 17053071, 17284223, 17473382, 17508343, 18084116, 18310307, 18556337, 18620562, 18840770, 19141582, 19167443, 19584681, 19956106, 20054344, 20357361, 20622162, 20628762, 20876716, 20948967, 21247498, 21584225, 21998398, 22162761, 22332874, 22357962, 22415876, 22446173, 22563461, 22567146, 23183535, 23403945, 23423694, 23473037, 23628620, 23803704, 23935095, 24340836, 24498006, 24844227, 25405207, 25562486, 25652388, 25669159, 26101329, 26216854, 26273670, 26405066, 26457418, 26513234, 26519333, 26615044, 26714416, 26856418, 26923214, 26981545, 27048654, 27240324, 27490775, 27506584, 27575603, 28263224, 28418115, 28526919, 28729721, 28877460, 28919263, 28941965, 29175121, 29300921, 29343548, 29404672, 29491866, 29597128, 29619531, 29851415, 29880650, 30092829, 30265185, 30352895, 30845908, 30953560, 30969375, 31264970, 31438962, 31442418, 31558459, 31775218, 31808541, 31913467, 31931479, 32061050, 32573495, 32634859, 32787907, 3280182, 32882526, 32959070, 3301484, 33033923, 33035311, 33154504, 33277338, 33419759, 33515070, 33542414, 33761612, 33813508, 33859325, 34083567, 34300672, 34326068, 34369627, 34720091, 35396829, 35404688, 35462792, 35499624, 35587468, 35742925, 35864094, 36282337, 36341551, 36368478, 36497105, 36701305, 36817429, 37188763, 37647325, 37724526, 37751304, 38161208, 39286976, 39522051, 39613428, 7573054, 7858104, 7909987, 7915880, 7977341, 7977386, 8121460, 8200980, 8301143, 8370928, 8447318, 8513574, 9556351, 9603916, 9844045
Diabetes Mellitus Type 1	Inhibit	15628976, 17883705, 20197308, 22401332, 24172699, 25642774, 26440526, 28380011, 29754174, 30352048, 31232620, 31256036, 31511930, 31756165, 32847960, 33837025, 34890117, 35155683, 35552392, 35918735, 36316084, 36920867, 37864241
Diabetes Mellitus Type 1	Stimulate	30970177
Diabetes Mellitus Type 2	Associate	10064105, 10347805, 10545531, 10947884, 11012908, 11118017, 11422660, 12118200, 12145235, 12369726, 12591951, 14551916, 14742839, 15233628, 15319170, 15337174, 15517149, 1569197, 15949705, 16089501, 16229747, 16814735, 16920849, 17227768, 17460697, 17551966, 17786204, 17971425, 18084116, 18162503, 18271689, 18310307, 18449463, 18496642, 18567820, 18647954, 18654034, 18719649, 18720028, 18772361, 18846047, 18985156, 19008344, 19033397, 1915117, 19183934, 19197265, 19211816, 19228808, 19258739, 19296078, 19324940, 19366866, 19430760, 19502414, 19504086, 19516902, 19570552, 19571666, 19581418, 19668377, 19773552, 19808892, 19903754, 20007936, 2002494, 20028940, 20182859, 20200314, 20226046, 20368233, 20390405, 20490451, 20581827, 20644627, 20701788, 20977574, 21099291, 21137020, 21181894, 21197403, 21234863, 21267535, 21325017, 21373834, 21484216, 21709297, 21760887, 21775499, 21828339, 21850561, 21917432, 21922457, 22114711, 22266116, 22403629, 22424623, 22457223, 22491740, 22510711, 22688337, 22688542, 22961080, 23257734, 23263489, 23308243, 23349674, 23369358, 23386398, 23468892, 23565163, 23715754, 24062323, 24086540, 24186880, 24337154, 24376643, 24429578, 24489861, 24695864, 24726898, 24728128, 24740571, 24905913, 24914535, 24925104, 25036354, 25105294, 25143351, 25157406, 25368101, 25370850, 25379510, 25463099, 25524916, 25565210, 25567348, 25605810, 25631608, 25635986, 25667308, 25712349, 25774510, 25775977, 25974167, 26269521, 26278286, 26289721, 26337083, 26337673, 26386696, 26606528, 26615044, 26779543, 27019061, 27072495, 27175665, 27280334, 27281091, 27448167, 27505441, 27535031, 27664094, 27896979, 27898283, 28012244, 28050343, 28252104, 28280335, 28334683, 28481223, 28607108, 28611053, 28684635, 28742858, 28789618, 28905132, 28919328, 28934129, 29141982, 29229776, 29414688, 29491224, 29631902, 29691896, 29712868, 29754174, 29768267, 29893513, 29945658, 29989852, 30092829, 30182532, 30190473, 30352895, 30728419, 30759032, 30863457, 30914061, 30945665, 30970177, 31085831, 31123324, 31208038, 31499737, 31558459, 31676859, 31697830, 31796987, 32017362, 32064729, 32182220, 32326243, 32341337, 32354719, 32433667, 32490905, 32887608, 32888406, 32894192, 32928872, 32938833, 33123595, 33209162, 33274206, 33490284, 33581131, 33617875, 33628196, 33711989, 33761612, 33966442, 33980776, 33989714, 34255930, 34502231, 34763485, 34907913, 34943951, 35046895, 35082198, 35163144, 35165256, 35184403, 35221617, 35260800, 35334221, 35657990, 35697299, 35841806, 35936218, 36018759, 36280617, 36368478, 36368953, 36463286, 36524461, 36543916, 36547924, 36693378, 36718853, 36749929, 37047308, 37108578, 37291636, 37442415, 37679740, 37716291, 37949941, 38027145, 38032738, 38049589, 38158370, 38219974, 39174611, 7913622, 8083355, 8108432, 8121460, 8675629, 8787686, 8911293, 8981937, 9011569, 9042926, 9078243, 9260775, 9449686, 9541507, 9560308
Diabetes Mellitus Type 2	Inhibit	12621037, 12685875, 17417692, 17683561, 18059616, 20724797, 21532749, 22492527, 22578083, 22977253, 23771925, 24705588, 25790476, 25879401, 27789766, 28150817, 28283687, 28758947, 29641741, 30149534, 30503831, 30912283, 31271312, 31756165, 32198214, 32722720, 32882526, 33251697, 33382877, 35040554, 35742925, 36111501, 36167523, 36282337, 36942376, 36944059, 37294632, 39273144, 8675652
Diabetes Mellitus Type 2	Stimulate	22615949
Diabetic Ketoacidosis	Inhibit	17855560, 23456528, 26530398, 28511139, 31196892, 35301072, 35518939
Diabetic Ketoacidosis	Associate	31196892, 31605659, 34888628, 35082198, 35992134, 9260775
Diabetic Nephropathies	Associate	18449463, 19091788, 2002627, 20197308, 36313763, 36314849, 36633903, 39562547
Diabetic Nephropathies	Inhibit	35846305, 36701305
Diabetic Neuropathies	Associate	30414308, 35992134
Diabetic Retinopathy	Associate	22341865, 23562823, 39900481
Diabetic Retinopathy	Stimulate	23144758, 37828117
Diarrhea	Associate	22486858
Diastrophic dysplasia	Inhibit	10487323
Disease	Associate	31734778, 36352383, 9486982
Disease Resistance	Associate	19710199, 24947026, 26691888, 32210717
Donohue Syndrome	Associate	20339196, 2365819, 293690, 3631076, 3883764, 6345588
Drug Related Side Effects and Adverse Reactions	Inhibit	20490276, 26084465
Drug Related Side Effects and Adverse Reactions	Stimulate	28631569, 35595809
Drug Related Side Effects and Adverse Reactions	Associate	33767265, 33806355, 36714559
Ductus Arteriosus Patent	Associate	19878864
Dwarfism Pituitary	Associate	15536873, 168059, 31073722, 9745853
Dwarfism Pituitary	Inhibit	5480844
Dysgammaglobulinemia	Stimulate	28329776
Dyslipidemias	Stimulate	25897955
Dyslipidemias	Associate	34001235, 35454146
Early Onset Glaucoma	Associate	30414308
Ectodermal Dysplasia	Inhibit	34750480
Embolism Fat	Associate	18388185, 33859622
Embolism Fat	Inhibit	20943748
Emphysema	Associate	16504044
Endocrine System Diseases	Associate	18620562, 27246810
Endometrial Neoplasms	Associate	15322863, 17233921, 26134033, 27125830, 28112250, 29297146, 33622671, 35437568, 36526973, 8314534
Epilepsy Temporal Lobe	Associate	25458098
Ermine phenotype	Inhibit	25595199
Esophageal Neoplasms	Associate	19360286
Essential Hypertension	Associate	25133511, 29369145
Essential Tremor	Associate	36753667
Fatigue	Associate	27966441
Fatigue Syndrome Chronic	Associate	25836975
Fatty Liver	Associate	20139635, 23516571, 27315352, 35013040, 37385614, 37511066
Fatty Liver Alcoholic	Associate	23394097, 28277977
Feeding and Eating Disorders	Associate	35015083
Fetal Alcohol Spectrum Disorders	Associate	18478238
Fetal Diseases	Associate	23150676
Fetal Growth Retardation	Stimulate	23836432
Fetal Growth Retardation	Associate	28254226, 35430618
Fever	Inhibit	28480665
Fibrosis	Associate	15951550, 20841504, 29451090
Fibrosis	Stimulate	21464041
Frontotemporal Dementia	Associate	24415571
Frontotemporal Lobar Degeneration	Associate	31081340
Gallstones	Associate	18375961
Gardner Syndrome	Inhibit	27444220
Gastrointestinal Stromal Tumors	Associate	18419060
Genetic Diseases Inborn	Associate	11207177, 13967777, 293690, 34890117, 7847376, 8529513
Gerstmann Syndrome	Associate	20032470
Gerstmann Syndrome	Stimulate	37572939
Glioblastoma	Associate	35513291
Glucagonoma	Inhibit	26496258
Glucose Intolerance	Associate	12322799, 17259403, 17426321, 18411240, 19375581, 19504086, 20195502, 21935364, 22733750, 23235198, 23952705, 24030943, 25043022, 28127622, 28611053, 29989852, 33581131, 33967958, 35015083, 35454146, 37949105, 9313101
Glucose Intolerance	Stimulate	16603055, 35843912
Glucose Metabolism Disorders	Associate	28905132
Glucosephosphate Dehydrogenase Deficiency	Associate	35806430
Granulosa Cell Tumor	Associate	34930403
Graves Disease	Inhibit	31756165
Growth Disorders	Associate	21467301, 34965699
HAIR AN syndrome	Associate	16284649, 28777829, 30649347, 37328795
Halal Setton Wang syndrome	Associate	34563042
Hearing Loss	Associate	28271591
Heart Diseases	Associate	19351735
Heart Diseases	Stimulate	32724489
Heart Failure	Associate	31508506, 32406318, 37909603
Hemochromatosis	Stimulate	20150954
Hemochromatosis	Associate	25985182
Hemolytic Uremic Syndrome	Associate	32950058
Hepatic Adenomas Familial	Inhibit	36167523
Hepatitis B	Associate	21464041
Hepatitis C	Associate	22862962, 23133528, 25645159
Hepatitis C Chronic	Associate	17131467, 30586166
Hereditary pancreatitis	Inhibit	26268075
Herpesviridae Infections	Associate	23912867
Hirsutism	Associate	15950641
Hirsutism	Stimulate	31771632
Huntington Disease	Associate	34445125
Hyper IgM Immunodeficiency Syndrome	Associate	18957614
Hyperandrogenism	Associate	22390153, 36793022
Hypercalcemia	Stimulate	35698198
Hyperglycemia	Associate	10545530, 16962112, 17855560, 18541587, 20185807, 22018645, 22266116, 23350652, 25042561, 25385439, 27643615, 28866834, 31605659, 32182220, 33967958, 34299331, 35184403, 36768715
Hyperglycemia	Inhibit	16075063, 18167556, 20705777, 20888904, 21236451, 22688337, 23985558, 25278226, 26819233, 28480665, 29624227, 30735706, 31740700, 34419042, 38066613
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	16926441, 19808892, 23674605, 25562888, 26247670, 31543974, 36633903, 8083355
Hyperglycemic Hyperosmolar Nonketotic Coma	Inhibit	21483870
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	30261196
Hyperinsulinemic hypoglycemia familial 6	Stimulate	11502802, 30367518
Hyperinsulinism	Associate	11207177, 1601997, 19773552, 20185807, 20843946, 22094332, 22390153, 27069678, 29034901, 33762279, 33967958, 34435596, 35578225, 36239000, 36384957, 36440205, 37454648, 6312455
Hyperinsulinism	Inhibit	18478343, 25042561
Hyperinsulinism	Stimulate	27074817, 28427228
Hyperlactatemia	Stimulate	34419042
Hyperlipidemia Familial Combined	Associate	10357835
Hyperlipidemias	Associate	16497841, 25944880, 36749274, 9260775
Hyperlipidemias	Inhibit	36167523
Hyperlipoproteinemia Type I	Associate	11993791
Hyperlipoproteinemia Type II	Associate	29574070
Hyperlipoproteinemia Type IV	Associate	33588820
Hyperphagia	Associate	35963866
Hyperplasia	Associate	20830240
Hyperproinsulinemia	Associate	1601997, 288074, 3470784, 4019786
Hypertension	Associate	11016797, 17086019, 23942764, 24786779, 29162152, 29369145, 32888289, 33176720
Hypertension	Stimulate	12358137, 20491605
Hypertension	Inhibit	36297114
Hypertension Pregnancy Induced	Associate	29381395
Hypertensive Nephropathy	Associate	33176720
Hypertriglyceridemia	Associate	33588820
Hypertriglyceridemic Waist	Associate	29574070
Hypertrophy	Inhibit	16400016
Hypertrophy	Associate	18388900
Hypertrophy	Stimulate	30890782
Hypoalphalipoproteinemias	Associate	33490284
Hypobetalipoproteinemias	Associate	20303351
Hypoglycemia	Associate	1281841, 18419060, 19053014, 21968108, 21979934, 23843578, 23990951, 28600547, 29648519, 30976983, 33040071, 34583764, 34830301, 35518939, 35665752, 37454648, 7847376
Hypoglycemia	Stimulate	18926903, 19058315, 20587725, 22401332, 25753915, 26399329, 26440526, 26819233, 30520387, 30535721, 30768625, 31073722, 35552392, 3917947, 4250364, 8797055, 8835601, 9076339, 9261935, 9923795
Hypoglycemia	Inhibit	35918735
hypoglycemic encephalopathy	Associate	18854428, 25562888, 31734778
hypoglycemic encephalopathy	Stimulate	9261935
Hypogonadism	Inhibit	26622051
Hypokalemia	Associate	34348722
Hypoparathyroidism	Associate	9617861
Hypothyroidism	Stimulate	33767671
Hypothyroidism	Inhibit	36167523
Hypotrichosis	Stimulate	25585504
Hypoxia	Stimulate	24134599
Hypoxia	Associate	29843131, 30237409, 34224918, 37759548
Ichthyosis Bullosa of Siemens	Associate	26166255
Immunologic Deficiency Syndromes	Stimulate	26400665
Immunologic Deficiency Syndromes	Associate	32634859
Infections	Inhibit	18037968
Infections	Associate	32077075
Infertility	Associate	31748790
Infertility	Stimulate	37949105, 37972259
Inflammation	Inhibit	12029093, 18037968, 18056792, 18556339, 20200310, 20956025, 23403945, 26718495, 29641741, 33740174
Inflammation	Associate	16418168, 16864906, 17551966, 18334611, 19841271, 20622004, 21203453, 21464440, 22025778, 22094332, 22415876, 23484124, 23529132, 23651848, 23811853, 24337154, 24346217, 24429578, 24521217, 25924856, 25944880, 26376914, 26974319, 27163744, 27518102, 28705613, 28809398, 29175121, 29430577, 30528273, 30863457, 30871567, 31835296, 31880859, 32077075, 33561210, 34671071, 34930403, 35352134, 36311488, 36793022, 36849131, 37170094, 37215099, 37820926
Inflammation	Stimulate	18614853, 20739510, 32049633, 34034759
Insulin Resistance	Associate	10207722, 10726903, 11109972, 11551849, 11707433, 12621164, 12832613, 12954593, 1446650, 1460020, 15339744, 15919832, 16002819, 16089501, 16395259, 16603055, 17030959, 17131467, 17227768, 17351274, 17563058, 17786204, 17908551, 17986714, 18270300, 18332089, 18364460, 18426863, 18670420, 19544118, 19570552, 19580964, 19668377, 19720790, 19720801, 19794059, 19841271, 20107109, 20339196, 20570822, 20739510, 20858286, 20930717, 21054880, 21318406, 21464990, 21593812, 21632466, 21757715, 21901158, 22297646, 22390153, 22596174, 22694222, 22721429, 22844517, 22862962, 22970944, 23133528, 23193206, 23308243, 23463496, 2365819, 23715754, 23855914, 24086540, 24306210, 2479553, 24947364, 24985106, 25059784, 25196736, 25463099, 25635986, 25641314, 2573522, 25832963, 26223240, 26284522, 26352439, 26386696, 26402673, 26525880, 26672043, 26742564, 26831110, 26884438, 26962819, 27111539, 27150866, 27280334, 27459314, 27535281, 27810898, 28042651, 28270597, 28866834, 29342149, 29362600, 293690, 29410345, 29893513, 30514227, 30571288, 30620635, 30623452, 30826467, 30863203, 30866603, 30939905, 30984779, 30992506, 31085831, 31200560, 31253200, 31301321, 31389668, 31499737, 31517621, 31739742, 31766080, 32122428, 32293066, 32382742, 32469141, 32536688, 32651353, 32725157, 3280314, 32886191, 33509040, 33728347, 3384956, 34051802, 34204938, 34718921, 34763485, 35163144, 35184403, 35221617, 35363363, 35409099, 35449053, 35579861, 35600576, 35634501, 35971929, 35987697, 35996309, 36316084, 36368953, 36693378, 36724370, 36782224, 37291194, 37309120, 37442415, 37453421, 37506691, 37587407, 37898813, 38009017, 38027137, 38032738, 38102588, 38136941, 38233797, 39174611, 39192263, 39684804, 40055326, 40380373, 6345588, 8529513, 8941652, 9218523, 9486982, 9560308
Insulin Resistance	Inhibit	16007256, 22590537, 23468892, 23651848, 25210878, 25879401, 27207326, 30322801, 31250990, 32375679, 33637536, 35110500, 35737707, 35841806, 37047308, 38103636, 7154104
Insulin Resistance	Stimulate	21479595, 22327199, 24757657, 24815457, 25472847, 25595199, 29046328, 29955086, 31679138, 32059761, 33479282, 33711016, 34034759
Insulinoma	Associate	14516279, 18451997, 19073775, 19545371, 22530041, 23891624, 33060578, 35428762, 36693378, 36847722, 9284735
Insulinoma	Stimulate	18252785
Insulinoma	Inhibit	20067955
Intellectual Disability	Associate	19053014
Islet cell tumor syndrome	Associate	23935095, 29300921
Kabuki syndrome	Stimulate	28102591
Keratoconus	Associate	25247416
Ketosis	Inhibit	15115830
Ketosis	Associate	16570164, 34886216, 36414599, 908763
Kidney Diseases	Inhibit	22162761
Kidney Diseases	Associate	30637974, 33967958, 34153873
Kidney Failure Chronic	Associate	11012908
Kidney Neoplasms	Associate	32349989
Laron Syndrome	Associate	28073935
Latent Autoimmune Diabetes in Adults	Associate	15932520, 18310307, 19001190, 20805278, 23194113
Latent Autoimmune Diabetes in Adults	Inhibit	19001190, 35784546, 35918735
Lesch Nyhan Syndrome	Associate	31714576
Leukemia	Associate	3291986, 4341701
Leukemia Erythroblastic Acute	Associate	7524086
Leukemia Lymphocytic Chronic B Cell	Associate	21307146
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	28757432
Leukemia Myeloid Acute	Associate	19789352, 34502231
Lewy Body Disease	Associate	29092095, 31081340
Light Fixation Seizure Syndrome	Stimulate	9389749
Lipid Metabolism Disorders	Inhibit	9260775
Lipoatrophy with diabetes hepatic steatosis cardiomyopathy and leukomelanodermic papules	Associate	18089690
Lipoatrophy with diabetes hepatic steatosis cardiomyopathy and leukomelanodermic papules	Stimulate	28329776, 3519971
Lipodystrophy	Stimulate	21479595
Lipodystrophy	Associate	23810379, 8529513
Lipomatosis	Associate	34187516
Liposarcoma	Associate	31069877
Lissencephaly X Linked 2	Associate	26633894
Liver Cirrhosis	Stimulate	21796809, 39809143
Liver Cirrhosis	Associate	27315352, 29565162, 31534089
Liver Diseases	Associate	37572939
Liver Diseases Alcoholic	Associate	22577490
Liver Failure	Inhibit	36167523
Liver Neoplasms	Associate	29618798
Long QT Syndrome	Associate	29548277
Lung Diseases	Associate	25278226, 8626706
Lupus Erythematosus Systemic	Associate	29755474
Major Affective Disorder 2	Associate	2898127
Malnutrition	Associate	11708577
Mason Type Diabetes	Inhibit	15139733
Mason Type Diabetes	Associate	20226046, 30182532
MASS syndrome	Associate	26886906
Maturity Onset Diabetes of the Young Type 1	Associate	30191603, 6312455
Maturity Onset Diabetes of the Young Type 2	Associate	37958824, 8878425
Maturity Onset Diabetes of the Young Type 3	Associate	29597128, 34035238, 9822613
Maturity Onset Diabetes of the Young Type 7	Associate	33604390
Melanoma	Associate	25953317, 30970006
Melanoma Cutaneous Malignant	Associate	33082316
Memory Disorders	Associate	18430999, 21694461
Memory Disorders	Inhibit	23507773, 31899862
Mental Disorders	Inhibit	17898989, 26606528
Mental Disorders	Associate	30391805, 32341337, 35165256
Mesenteric Ischemia	Associate	24346217
Metabolic Diseases	Associate	16814735, 17563058, 21979934, 22457223, 24996265, 26136127, 26788516, 27070751, 27597954, 29131315, 29203791, 29893513, 30775986, 30945665, 31362984, 33859622, 34930403, 35363363, 35578225, 35996309, 36111501, 36714559, 36988872
Metabolic Diseases	Inhibit	24265536
Metabolic Diseases	Stimulate	27069678, 32107266
Metabolic Syndrome	Associate	16602826, 1713812, 17351274, 21266669, 21508135, 21904299, 21962038, 22185674, 22479213, 22584727, 23375099, 23515448, 23669880, 23736306, 23855914, 24358323, 24455214, 26084465, 26202599, 26470795, 27101299, 27133621, 27301461, 29369145, 31502573, 31739742, 32122428, 33637536, 34801968, 35165256, 37904219, 38181524, 39217505
Metabolic Syndrome	Stimulate	20032477, 22129309, 24484717, 29658358, 33764994
Metabolic Syndrome	Inhibit	24786779
Microsatellite Instability	Associate	18992263
Mitchell Riley Syndrome	Associate	35813646
Mitochondrial Diseases	Associate	19093000, 21464990, 21555852, 27966441, 28252104, 36313763
Mitochondrial Diseases	Stimulate	19332493, 25731694
Mitochondrial Diseases	Inhibit	20490276
Mitochondrial Myopathies	Associate	31630688
Mitochondrial Myopathy with Diabetes	Associate	19073775
Multiple Myeloma	Associate	20844560
Multiple Organ Failure	Inhibit	16075063
Muscle Neoplasms	Associate	28705613, 39337673
Muscular Diseases	Associate	27111539, 27966441
Muscular Dystrophy Duchenne	Associate	33004909
Myocardial Infarction	Associate	14629464, 22018645, 31508506
Myocardial Infarction	Stimulate	25696117
Myocardial Ischemia	Stimulate	31508506
Myocardial Ischemia	Associate	32406318
Myopia	Stimulate	33973916
Myostatin related muscle hypertrophy	Stimulate	3519971
Myotonia with Skeletal Abnormalities and Mental Retardation	Associate	30901379
Myotonic Dystrophy	Associate	11422660, 1142379, 16920849, 18271689, 20339196, 20930717, 22341865, 22558111, 28915272, 30901379, 32553458, 7951555
Myotonic Dystrophy	Inhibit	24243639, 27849238, 29546061, 30845774
Narcolepsy	Associate	34745571
Necrosis	Associate	24626736
Neonatal onset citrullinemia type 2	Associate	28516797
Neoplasm Metastasis	Stimulate	12950263
Neoplasm Metastasis	Associate	28112250, 30229539, 34841688, 35672854, 36054930
Neoplasms	Associate	12610512, 1281841, 14516279, 15970649, 18252785, 1905701, 19545371, 19773552, 20182859, 2108946, 21099298, 21179032, 22341865, 22554284, 23837608, 24282611, 24858012, 24938479, 25169894, 25701261, 25749525, 26077721, 26084465, 26850040, 27364358, 27415018, 27842582, 28112250, 28631569, 29022062, 30277539, 30987250, 31211453, 32198016, 32733384, 34191793, 34554347, 37234805, 3905997, 8626706
Neoplasms	Stimulate	24131755, 29486734, 30657911, 35403707, 36526973, 37461077
Neoplasms	Inhibit	24184209, 30729133
Neoplasms Adipose Tissue	Associate	17317761, 18716044, 19148120, 22596174, 22895107, 34872092, 35970449
Neoplasms Adipose Tissue	Stimulate	23089338, 26514561
Neoplasms Adipose Tissue	Inhibit	23651848, 27207519, 30758089
Nerve Degeneration	Associate	18616667
Nerve Degeneration	Inhibit	21517693
Neuralgia	Inhibit	21517693
Neuroblastoma	Associate	17156427, 20490276, 20667453, 23710710, 7986393
Neurodegenerative Diseases	Associate	19387107, 26010513, 30149534, 31081340, 31270305
Neuroendocrine Tumors	Associate	34583764, 36191342, 37234805, 40281248, 9665483
Neuroinflammatory Diseases	Associate	24332562, 31081340
Neurologic Manifestations	Associate	26095650
Neurotoxicity Syndromes	Associate	26010513
Nevus	Associate	8440904
Non alcoholic Fatty Liver Disease	Associate	20888662, 21865331, 22215535, 23931760, 23977033, 25457209, 25774664, 27451965, 27455252, 29118014, 31534089, 32603046, 33206859, 34449768, 35312185
Non functioning pancreatic endocrine tumor	Associate	29070792
Noninsulin dependent diabetes mellitus with deafness	Associate	27966441, 31630688, 36313763
Obesity	Associate	11001753, 11283790, 12055319, 12109775, 12855762, 14569045, 15010337, 15044667, 15231849, 15298982, 16129713, 16277018, 16339118, 16403952, 16460444, 16784178, 16896161, 17030959, 17184146, 17639020, 17705672, 17986714, 18059616, 18078524, 18270300, 18303080, 18336063, 18375961, 18460597, 18535193, 18654034, 18719649, 19197265, 19214176, 19225211, 19247282, 19570552, 19820914, 20139635, 20466783, 20534142, 20619427, 20678967, 20829805, 21203453, 21286499, 21737012, 21760887, 21852675, 21873552, 21904299, 21907990, 22044490, 22185674, 22265870, 22278432, 22433619, 22457223, 22510711, 22694222, 22711164, 22970944, 23150676, 23289013, 23463496, 23529132, 23583180, 23651848, 24062323, 24141239, 24178789, 24337154, 24422628, 24521217, 24719315, 24996265, 25210878, 25369206, 25370852, 25517289, 25642424, 25731694, 25774664, 25944880, 26084465, 26136127, 26147062, 26232099, 26376914, 26386696, 26868993, 26871994, 26886906, 27052493, 27069678, 27379957, 27477082, 27545890, 27759977, 27883272, 28034763, 28042651, 28106509, 28474384, 28570579, 29086510, 29112142, 29193093, 29228058, 29295838, 29574070, 29645064, 29693476, 29893513, 30045424, 30309776, 30481042, 30528280, 30758089, 30826467, 30871567, 30912283, 30936085, 31091445, 31197173, 31234367, 31504107, 31766080, 31879755, 31982479, 32017362, 32033349, 32064729, 32198214, 32311037, 32544194, 32599690, 32820223, 33185172, 33348678, 33684170, 33859622, 33933146, 33998291, 34457110, 34467673, 34554347, 34620218, 34930403, 35247066, 35454146, 35578225, 35587468, 35766976, 35843386, 35963866, 36231008, 36297056, 36451420, 36609306, 36849131, 36988872, 37004031, 37373436, 37385614, 37716291, 37800791, 38216702, 38250713, 8150099, 9218523
Obesity	Stimulate	12055322, 14694215, 19332493, 24885899, 27246401, 27377425, 27465935, 28453173, 29301242, 29854435, 30009507, 30017803, 30572569, 33185172, 35703718, 37219669
Obesity	Inhibit	18565643, 24819376, 25879401, 27821717, 28338072, 28600576, 29737494, 30845774, 35409282
Obesity Abdominal	Associate	18388900, 18541587, 23715754
Obesity Maternal	Associate	24498006, 25322273, 25731694, 29093265, 35970449
Obesity Maternal	Inhibit	28338072, 37653058
Obesity Metabolically Benign	Inhibit	21726156, 30484514
Obesity Metabolically Benign	Associate	25920773, 34816598
Obesity Metabolically Benign	Stimulate	34457110
Obesity Morbid	Associate	21904299, 24901105, 27545890
Obsessive Compulsive Disorder	Associate	32341337, 35165256, 37587247
Oculocutaneous albinism type 2	Inhibit	10487323
Optic Atrophy	Associate	35010780
Osteoarthritis	Associate	33382877
Osteoglophonic dwarfism	Associate	22308218
Osteoporosis	Associate	22698912, 35758378, 36316863
Osteoporosis pseudoglioma syndrome	Associate	31091445
Ovarian Neoplasms	Associate	35761259, 36932437, 36936171, 8557160
Overnutrition	Associate	11708577
Overweight	Associate	15044667, 19470471, 21203453, 23463496, 25369206, 25923461, 30758089, 31504107, 32371932, 32478429, 32659272
Overweight	Stimulate	15628976, 29854435, 37450433
Overweight	Inhibit	27821717
Pancreatic Diseases	Inhibit	36414599
Pancreatic Neoplasms	Associate	19571666, 20663861, 28360038, 30838710, 32235821
Pancreatitis	Associate	18535540, 26633894, 32725157, 34155619, 35002959, 38273351
Pancreatitis Chronic	Associate	29659906
Paraparesis	Inhibit	31866237
Parkinson Disease	Associate	22952715, 25169894, 25646437, 26134514, 30640362, 31081340, 34745571
Periodontal Diseases	Associate	25924856
Phosphoglycerate Kinase 1 Deficiency	Associate	9389749
Pituitary Hormone Deficiency Combined 2	Inhibit	23064477
Plaque Amyloid	Associate	24652830
Plaque Atherosclerotic	Associate	22341865
Pneumonia Lipid	Stimulate	21963507, 30969375
Pneumonia Lipid	Associate	37014770
Polycystic Kidney Diseases	Associate	9264009
Polycystic Ovary Syndrome	Associate	10927066, 10973656, 11109972, 12849814, 14556818, 15374726, 16603055, 16785159, 17070195, 17520407, 17563058, 17898989, 17953957, 17953969, 18332089, 18560589, 18768676, 18854391, 18976759, 19094425, 19351735, 19544118, 19837928, 20041287, 20388053, 21300335, 21824047, 22035022, 22296324, 22296403, 22390153, 22468791, 22584727, 22648908, 22900502, 22904171, 22985947, 23198915, 23748472, 24040456, 24189751, 25554608, 25595199, 25695884, 26136127, 26335185, 26868993, 27052493, 27429113, 27459314, 27505055, 27748298, 28222635, 28337819, 28617068, 28949260, 28954502, 29029022, 29363717, 30382797, 30477916, 30527840, 30623452, 30668196, 30953560, 30959948, 32382742, 32574161, 32772928, 32785222, 33341231, 33579525, 33728347, 33859622, 34022900, 35270805, 35393909, 35758378, 35771237, 35843386, 36011374, 36139396, 36182923, 36291122, 36695944, 36793022, 36799021, 37358742, 38164524, 38213994, 7635975, 7920895, 8150099
Polycystic Ovary Syndrome	Stimulate	16316841, 20170341, 23830153, 23981122, 25467041, 25585504, 31340838, 31771632, 36157441
Polycystic Ovary Syndrome	Inhibit	19580964, 35409282, 36286390
Polyendocrinopathies Autoimmune	Associate	30979797
Post Acute COVID 19 Syndrome	Associate	37915075
Prader Willi Syndrome	Associate	16231029, 17449920, 22193922, 33067796
Prader Willi Syndrome	Inhibit	17596650, 17666087, 26334732, 31974460
Pre Eclampsia	Associate	24591340, 28566469, 29381395
Precancerous Conditions	Associate	30838710
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	34438446
Prediabetic State	Associate	23423694, 24062323, 28757432, 35971929
Pregnancy Complications	Associate	37972259
Pregnancy in Diabetics	Inhibit	23197113
Primary Ovarian Insufficiency	Associate	14556818
Prostatic Hyperplasia	Associate	29129118
Prostatic Neoplasms	Associate	12610512, 15880482, 23251408, 25683512, 25720493, 29249638, 33036464, 35670774, 36931467
Prostatic Neoplasms	Stimulate	16884534, 28732480
Proteinuria	Associate	27966441, 9617861
Pseudohypoparathyroidism	Associate	24030943
Psychotic Disorders	Associate	29523870
Puberty Precocious	Associate	30249230
Puberty Precocious	Stimulate	32496827
Pulmonary Disease Chronic Obstructive	Associate	31409982, 32050955
Renal cysts and diabetes syndrome	Associate	35992134
Renal Insufficiency	Associate	19584681
Renal Insufficiency	Stimulate	34034759
Respiratory Distress Syndrome	Associate	10794792
Respiratory System Abnormalities	Associate	29175121
Retinal Diseases	Associate	22266116
Retinoblastoma	Associate	17604597
Rhabdoid Tumor Predisposition Syndrome 1	Associate	17506723
Rhabdomyolysis	Associate	33153458
Rhabdomyosarcoma	Stimulate	8454633
Ring Chromosome 20 Syndrome	Inhibit	33767671
Salter Harris Fractures	Inhibit	16400016
Sarcopenia	Associate	37909603
Schizophrenia	Associate	20161799, 29722909, 35165256
Schizophrenia	Stimulate	30100396
Seizures	Stimulate	22977253
Seizures	Associate	24138066
Seizures	Inhibit	28480665
Severe Acute Respiratory Syndrome	Associate	35587468
Silver Russell Syndrome	Associate	22170793
Simpson Golabi Behmel syndrome	Associate	28566443, 31739742
Skin Manifestations	Associate	18556337
Sleep Apnea Obstructive	Associate	22451332, 30719767, 34449768, 36174398
Sleep Deprivation	Inhibit	27900260
Sleep Initiation and Maintenance Disorders	Associate	21494683
Snoring	Associate	21286499
Soft Tissue Injuries	Associate	21197447, 22022575
Spinocerebellar Ataxias	Associate	20009116
Status Asthmaticus	Associate	26722602, 28599074
Stiff Skin Syndrome	Associate	22998737
Stomach Neoplasms	Inhibit	23907334
Stomach Neoplasms	Associate	26084465, 34554347
Stroke	Associate	31630688
Substance Related Disorders	Associate	35864094
Sweet Syndrome	Associate	26942844
Syncope	Stimulate	22977253
Syndrome	Associate	1713812
Syndrome	Stimulate	33764994
Synucleinopathies	Associate	29092095
Systemic carnitine deficiency	Associate	16896161
Systemic Inflammatory Response Syndrome	Inhibit	24346217
Tangier Disease	Associate	19556721
Telomeric 22q13 Monosomy Syndrome	Associate	27577546
Thalassemia Beta+ Silent Allele	Associate	30501031
Thrombocytopenia	Associate	27759896, 8981925
Thrombophilia	Stimulate	18614853
Thrombosis	Inhibit	12850828
Thrombosis	Associate	17551966
Thyroid Cancer Papillary	Associate	30657911, 34537745
Thyroid Diseases	Associate	38164867
Thyroid Neoplasms	Associate	32846846, 33903625
Thyroiditis	Associate	30657911
Thyroiditis Autoimmune	Associate	15928253, 19141582, 31350776
Thyrotropin Biologically Inactive	Associate	18716044
Tooth Loss	Associate	23197113, 35499624
Triple Negative Breast Neoplasms	Associate	25341922
Tuberous Sclerosis	Associate	25268093
Turner Syndrome	Inhibit	19567529
Uniparental disomy of 13	Inhibit	39354420
Urinary Bladder Diseases	Associate	30729133
Urinary Bladder Neoplasms	Associate	17116246, 27350368
Uterine Cervicitis	Associate	31351582
Vascular Diseases	Associate	20587725, 21515851, 22709426, 27009027, 30871567
Vascular Diseases	Inhibit	22808198
Ventricular Fibrillation	Inhibit	19475663
Virilism	Associate	20357370
Virus Diseases	Inhibit	29415896
Virus Diseases	Associate	30265185
Vitamin D Deficiency	Stimulate	33767671, 36178657
Vitamin D Deficiency	Associate	34836301
Weight Gain	Inhibit	27958632
Weight Gain	Associate	29295838, 31560688, 9313101
Weight Loss	Stimulate	16129713, 20699619, 21505148, 26916363, 28245099, 34943997
Weight Loss	Associate	19504086, 21846802, 22138333, 22998737, 23687104, 25504030, 26062634, 27379957, 27732859, 28679551, 28770230, 28797697, 29086510, 29737494, 30385096, 30481042, 31519890, 34684639, 35897098, 37358742, 38599278
Weight Loss	Inhibit	36297056
Williams Syndrome	Associate	33564861
Wolcott Rallison syndrome	Associate	20007936
Wolfram Syndrome	Associate	21517693, 28271591, 34792267
Wolman Disease	Associate	32365792
Wounds and Injuries	Associate	24346217