Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3627
Gene name	C-X-C motif chemokine ligand 10
Gene symbol	CXCL10
Synonyms (NCBI Gene)	C7IFI10INP10IP-10SCYB10crg-2gIP-10mob-1
Chromosome	4
Chromosome location	4q21.1
Summary	This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of

121

Show/Hide all (121)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438112	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438109	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438110	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438108	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438112	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438109	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438110	hsa-miR-21-5p	qRT-PCR	24889251
MIRT438108	hsa-miR-21-5p	qRT-PCR	24889251
MIRT659959	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT659958	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT659957	hsa-miR-4288	HITS-CLIP	23824327
MIRT659956	hsa-miR-632	HITS-CLIP	23824327
MIRT659955	hsa-miR-1231	HITS-CLIP	23824327
MIRT540522	hsa-miR-3609	PAR-CLIP	21572407
MIRT540521	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT540520	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540519	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT540518	hsa-miR-520h	PAR-CLIP	21572407
MIRT540517	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT540516	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540515	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540514	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT540513	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT540512	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT540511	hsa-miR-612	PAR-CLIP	21572407
MIRT540510	hsa-miR-6860	PAR-CLIP	21572407
MIRT540509	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT540507	hsa-miR-4522	PAR-CLIP	21572407
MIRT540506	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT540505	hsa-miR-661	PAR-CLIP	21572407
MIRT540504	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540503	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT540502	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT540501	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT540500	hsa-miR-3672	PAR-CLIP	21572407
MIRT540499	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT540522	hsa-miR-3609	PAR-CLIP	21572407
MIRT540521	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT540520	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540519	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT540518	hsa-miR-520h	PAR-CLIP	21572407
MIRT540517	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT540516	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540515	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540514	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT540513	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT540512	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT540511	hsa-miR-612	PAR-CLIP	21572407
MIRT540510	hsa-miR-6860	PAR-CLIP	21572407
MIRT540509	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT540508	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT540507	hsa-miR-4522	PAR-CLIP	21572407
MIRT540506	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT540505	hsa-miR-661	PAR-CLIP	21572407
MIRT540504	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540503	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT540502	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT540501	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT540500	hsa-miR-3672	PAR-CLIP	21572407
MIRT540499	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT737638	hsa-miR-15a-5p	Luciferase reporter assay	26845678
MIRT731341	hsa-miR-15a-5p	Luciferase reporter assay	26845678
MIRT733146	hsa-miR-155-5p	qRT-PCR	31766503
MIRT733147	hsa-miR-34a-5p	qRT-PCR	31766503
MIRT733147	hsa-miR-34a-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCRFlow cytometryELISA	33229509
MIRT736411	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT659959	hsa-miR-1226-3p	HITS-CLIP	23824327
MIRT659958	hsa-miR-767-5p	HITS-CLIP	23824327
MIRT659957	hsa-miR-4288	HITS-CLIP	23824327
MIRT659956	hsa-miR-632	HITS-CLIP	23824327
MIRT659955	hsa-miR-1231	HITS-CLIP	23824327
MIRT540522	hsa-miR-3609	PAR-CLIP	21572407
MIRT540521	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT540520	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540519	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT540518	hsa-miR-520h	PAR-CLIP	21572407
MIRT540517	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT540516	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540515	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540514	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT540513	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT540512	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT540511	hsa-miR-612	PAR-CLIP	21572407
MIRT540510	hsa-miR-6860	PAR-CLIP	21572407
MIRT540509	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT540507	hsa-miR-4522	PAR-CLIP	21572407
MIRT540506	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT540505	hsa-miR-661	PAR-CLIP	21572407
MIRT540504	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540503	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT540502	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT540501	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT540500	hsa-miR-3672	PAR-CLIP	21572407
MIRT540499	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT540522	hsa-miR-3609	PAR-CLIP	21572407
MIRT540521	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT540520	hsa-miR-3664-5p	PAR-CLIP	21572407
MIRT540519	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT540518	hsa-miR-520h	PAR-CLIP	21572407
MIRT540517	hsa-miR-3065-5p	PAR-CLIP	21572407
MIRT540516	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT540515	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540514	hsa-miR-1285-3p	PAR-CLIP	21572407
MIRT540513	hsa-miR-3187-5p	PAR-CLIP	21572407
MIRT540512	hsa-miR-5189-5p	PAR-CLIP	21572407
MIRT540511	hsa-miR-612	PAR-CLIP	21572407
MIRT540510	hsa-miR-6860	PAR-CLIP	21572407
MIRT540509	hsa-miR-3120-5p	PAR-CLIP	21572407
MIRT540508	hsa-miR-302a-5p	PAR-CLIP	21572407
MIRT540507	hsa-miR-4522	PAR-CLIP	21572407
MIRT540506	hsa-miR-873-3p	PAR-CLIP	21572407
MIRT540505	hsa-miR-661	PAR-CLIP	21572407
MIRT540504	hsa-miR-196a-3p	PAR-CLIP	21572407
MIRT540503	hsa-miR-200c-5p	PAR-CLIP	21572407
MIRT540502	hsa-miR-550a-3p	PAR-CLIP	21572407
MIRT540501	hsa-miR-6888-3p	PAR-CLIP	21572407
MIRT540500	hsa-miR-3672	PAR-CLIP	21572407
MIRT540499	hsa-miR-6864-3p	PAR-CLIP	21572407
MIRT755530	hsa-miR-149-3p	qRT-PCR	36250208
MIRT2207912	hsa-miR-4716-5p	CLIP-seq
MIRT2435120	hsa-miR-570	CLIP-seq

Show/Hide all (9)

Transcription factor	Regulation	Reference
IRF1	Activation	19342664
IRF3	Activation	18691624;24257594
IRF7	Activation	24701034
NFKB1	Activation	16982926;20164184;24701034
NFKB1	Unknown	16818736;19479051;24257594
RELA	Activation	16982926;20164184;24701034
RELA	Unknown	16818736;19479051;24257594
STAT1	Repression	22022583
STAT1	Unknown	19479051;23153456

Show/Hide all (69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	IEA
GO:0005102	Function	Signaling receptor binding	TAS	10201891
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	18275857, 21314817, 28381538
GO:0005576	Component	Extracellular region	IDA	20041150
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0006935	Process	Chemotaxis	IDA	12782716
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	TAS	10903763
GO:0006952	Process	Defense response	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	TAS	10903763
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	TAS	10201891
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	10903763
GO:0007186	Process	G protein-coupled receptor signaling pathway	IMP	12782716
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	12782716
GO:0007267	Process	Cell-cell signaling	TAS	3925348
GO:0007517	Process	Muscle organ development	TAS	8798675
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	12782716
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	TAS	10903763
GO:0008015	Process	Blood circulation	TAS	8798675
GO:0008201	Function	Heparin binding	IMP	18645041
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8798675
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	TAS	10903763
GO:0009617	Process	Response to bacterium	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010818	Process	T cell chemotaxis	IMP	18645041
GO:0010819	Process	Regulation of T cell chemotaxis	IDA	8608232
GO:0010996	Process	Response to auditory stimulus	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IDA	7540647
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0031640	Process	Killing of cells of another organism	IDA	12949249
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033280	Process	Response to vitamin D	IEA
GO:0034605	Process	Cellular response to heat	IEA
GO:0042056	Function	Chemoattractant activity	IDA	11157474
GO:0042118	Process	Endothelial cell activation	IGI	19470579
GO:0042127	Process	Regulation of cell population proliferation	IDA	12782716
GO:0042981	Process	Regulation of apoptotic process	IDA	22652417
GO:0045236	Function	CXCR chemokine receptor binding	IBA
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	12782716
GO:0048248	Function	CXCR3 chemokine receptor binding	IDA	12782716
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	12782716
GO:0051607	Process	Defense response to virus	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	12949249
GO:0070098	Process	Chemokine-mediated signaling pathway	IBA
GO:0070098	Process	Chemokine-mediated signaling pathway	IMP	18645041
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	23776175
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	8608232
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:0098586	Process	Cellular response to virus	IEP	28146100
GO:0140374	Process	Antiviral innate immune response	IEP	25930096
GO:1901509	Process	Regulation of endothelial tube morphogenesis	IDA	16484616
GO:1901740	Process	Negative regulation of myoblast fusion	IEA
GO:2000406	Process	Positive regulation of T cell migration	IDA	23620790

MIM	HGNC	e!Ensembl
147310	10637	ENSG00000169245

P02778

Protein name

C-X-C motif chemokine 10 (10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (Small-inducible cytokine B10) [Cleaved into: CXCL10(1-73)]

Protein function

Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (PubMed:11157474

PDB

1LV9 , 1O7Y , 1O7Z , 1O80 , 8K2X

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00048	IL8	28 → 89	Small cytokines (intecrine/chemokine), interleukin-8 like	Domain

Tissue specificity

TISSUE SPECIFICITY: Mainly secreted by monocytes, endothelial cells as well as fibroblasts. Expressed by epithelial cells in thymus (PubMed:11157474). Microglial cells produce CXCL10 in response to viral stimulation (PubMed:12663757). {ECO:0000269|PubMed:

Sequence

MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRV
EIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Toll-like receptor signaling pathway RIG-I-like receptor signaling pathway Cytosolic DNA-sensing pathway IL-17 signaling pathway TNF signaling pathway Hepatitis C Influenza A Epstein-Barr virus infection Coronavirus disease - COVID-19		Chemokine receptors bind chemokines G alpha (i) signalling events Interleukin-10 signaling

CXCL10 (C-X-C motif chemokine ligand 10)