Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3621
Gene name Gene Name - the full gene name approved by the HGNC.
Inhibitor of growth family member 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ING1
Synonyms (NCBI Gene) Gene synonyms aliases
p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
Chromosome Chromosome number
13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
13q34
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduc
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs121909250 G>C Pathogenic Missense variant, coding sequence variant
rs121909251 A>G Pathogenic Missense variant, coding sequence variant
rs121909252 C>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006996 hsa-miR-662 Luciferase reporter assay 21528065
MIRT006996 hsa-miR-662 Luciferase reporter assay 21528065
MIRT006996 hsa-miR-662 Luciferase reporter assay 21528065
MIRT006996 hsa-miR-662 Luciferase reporter assay 21528065
MIRT026987 hsa-miR-103a-3p Sequencing 20371350
Transcription factors
Transcription factor Regulation Reference
RUNX3 Activation 17956589
TP53 Unknown 16465410
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II NAS 9651585, 22865885
GO:0005515 Function Protein binding IPI 18388957, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus NAS 10866301, 28554894
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601566 6062 ENSG00000153487
Protein
UniProt ID Q9UK53
Protein name Inhibitor of growth protein 1
Protein function Cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. Implicated as a tumor suppressor gene.
PDB 2QIC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12998 ING 187 256 Inhibitor of growth proteins N-terminal histone-binding Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expre
Sequence
MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSL
GLQPWIGSSRCWGGPCSSALRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAW
RVSPLPLSPLSPATFGRGFIAVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRG
WGRAWPWKQILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVE
LVENRTRQVDSHVELF
EAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNE
NRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQ
VSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAY
NR
Sequence length 422
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Carcinoma Of The Head And Neck squamous cell carcinoma of the head and neck rs121909250, rs121909251, rs121909252 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Inhibit 12835295
Breast Neoplasms Associate 15365563, 26306560, 37459799
Breast Neoplasms Stimulate 37072777
Burkitt Lymphoma Inhibit 10577281
Carcinogenesis Associate 15534913, 16273637, 18533182, 21731648, 23585863
Carcinoma Hepatocellular Associate 15800978
Carcinoma Non Small Cell Lung Associate 21779982, 30372865
Cell Transformation Neoplastic Associate 18533182
Colorectal Neoplasms Associate 16273637, 37072777
Esophageal Neoplasms Stimulate 37072777