ING1 (inhibitor of growth family member 1)

Gene Gene information from NCBI Gene database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID 3621
Gene name Inhibitor of growth family member 1
Gene symbol ING1
Synonyms (NCBI Gene)
p24ING1cp33p33ING1p33ING1bp47p47ING1a
Chromosome 13
Chromosome location 13q34
Summary This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduc
SNPs SNP information provided by dbSNP.
3
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (3)
SNP ID Visualize variation Clinical significance Consequence
rs121909250 G>C Pathogenic Missense variant, coding sequence variant
rs121909251 A>G Pathogenic Missense variant, coding sequence variant
rs121909252 C>A Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
154
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (154)
miRTarBase ID miRNA Experiments Reference
MIRT006996 hsa-miR-662 Luciferase reporter assay 21528065
MIRT006996 hsa-miR-662 Luciferase reporter assay 21528065
MIRT006996 hsa-miR-662 Luciferase reporter assay 21528065
MIRT006996 hsa-miR-662 Luciferase reporter assay 21528065
MIRT026987 hsa-miR-103a-3p Sequencing 20371350
Transcription factors Transcription factors information provided by TRRUST V2 database.
2
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (2)
Transcription factor Regulation Reference
RUNX3 Activation 17956589
TP53 Unknown 16465410
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (20)
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II NAS 9651585, 22865885
GO:0005515 Function Protein binding IPI 18388957, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IEA
GO:0005634 Component Nucleus NAS 10866301, 28554894
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
601566 6062 ENSG00000153487
Protein Protein information from UniProt database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UK53
Protein name Inhibitor of growth protein 1
Protein function Cooperates with p53/TP53 in the negative regulatory pathway of cell growth by modulating p53-dependent transcriptional activation. Implicated as a tumor suppressor gene.
PDB 2QIC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12998 ING 187 → 256 Inhibitor of growth proteins N-terminal histone-binding Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Isoform 2 was expressed in all normal tissues and cells examined, as well as in all breast cancer and melanoma cell lines examined. Isoform 3 was expressed in testis, liver, and kidney, weakly expressed in colon and brain and not expre
Sequence 
MSFVECPYHSPAERLVAEADEGGPSAITGMGLCFRCLLFSFSGRSGVEGGRVDLNVFGSL
GLQPWIGSSRCWGGPCSSALRCGWFSSWPPPSKSAIPIGGGSRGAGRVSRWPPPHWLEAW
RVSPLPLSPLSPATFGRGFIAVAVIPGLWARGRGCSSDRLPRPAGPARRQFQAASLLTRG
WGRAWPWKQILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVE
LVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNE
NRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQ
VSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAY
NR
Sequence length 422
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
3
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Squamous cell carcinoma of the head and neck Pathogenic rs121909250, rs121909251, rs121909252 RCV000008533
RCV000008534
RCV000008535
Show/Hide Text Mining Associations (29)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Inhibit 12835295
Breast Neoplasms Associate 15365563, 26306560, 37459799
Breast Neoplasms Stimulate 37072777
Burkitt Lymphoma Inhibit 10577281
Carcinogenesis Associate 15534913, 16273637, 18533182, 21731648, 23585863
Carcinoma Hepatocellular Associate 15800978
Carcinoma Non Small Cell Lung Associate 21779982, 30372865
Cell Transformation Neoplastic Associate 18533182
Colorectal Neoplasms Associate 16273637, 37072777
Esophageal Neoplasms Stimulate 37072777