Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3611
Gene name Gene Name - the full gene name approved by the HGNC.	Integrin linked kinase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ILK
Synonyms (NCBI Gene) Gene synonyms aliases	HEL-S-28, ILK-1, ILK-2, P59, p59ILK
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11p15.4
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of t

Show/Hide all(123)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006720	hsa-miR-625-5p	Immunoblot, Immunohistochemistry, Luciferase reporter assay, qRT-PCR	22677169
MIRT007009	hsa-miR-542-3p	Immunoblot, Immunocytochemistry, Luciferase reporter assay	21860426
MIRT007180	hsa-miR-145-5p	Luciferase reporter assay, qRT-PCR, Western blot	23104321
MIRT046790	hsa-miR-222-3p	CLASH	23622248
MIRT037481	hsa-miR-744-5p	CLASH	23622248
MIRT451921	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT451920	hsa-miR-889-5p	PAR-CLIP	23592263
MIRT451919	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT451918	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT451917	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT451916	hsa-miR-3179	PAR-CLIP	23592263
MIRT451915	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT451914	hsa-miR-3202	PAR-CLIP	23592263
MIRT451913	hsa-miR-711	PAR-CLIP	23592263
MIRT451912	hsa-miR-3652	PAR-CLIP	23592263
MIRT451911	hsa-miR-4430	PAR-CLIP	23592263
MIRT451910	hsa-miR-4505	PAR-CLIP	23592263
MIRT451909	hsa-miR-5787	PAR-CLIP	23592263
MIRT451908	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT451907	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT451906	hsa-miR-4271	PAR-CLIP	23592263
MIRT451905	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT451904	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT006720	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451903	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451902	hsa-miR-5698	PAR-CLIP	23592263
MIRT451901	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451900	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451899	hsa-miR-4525	PAR-CLIP	23592263
MIRT451898	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451897	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT451896	hsa-miR-6842-3p	PAR-CLIP	23592263
MIRT451895	hsa-miR-1275	PAR-CLIP	23592263
MIRT451894	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT007009	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT007009	hsa-miR-542-3p	Immunohistochemistry, Luciferase reporter assay, Western blot	26286747
MIRT451921	hsa-miR-6757-5p	PAR-CLIP	23592263
MIRT451920	hsa-miR-889-5p	PAR-CLIP	23592263
MIRT451919	hsa-miR-128-3p	PAR-CLIP	23592263
MIRT451918	hsa-miR-216a-3p	PAR-CLIP	23592263
MIRT451917	hsa-miR-3681-3p	PAR-CLIP	23592263
MIRT451916	hsa-miR-3179	PAR-CLIP	23592263
MIRT451915	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT451914	hsa-miR-3202	PAR-CLIP	23592263
MIRT451913	hsa-miR-711	PAR-CLIP	23592263
MIRT451912	hsa-miR-3652	PAR-CLIP	23592263
MIRT451911	hsa-miR-4430	PAR-CLIP	23592263
MIRT451910	hsa-miR-4505	PAR-CLIP	23592263
MIRT451909	hsa-miR-5787	PAR-CLIP	23592263
MIRT451908	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT451907	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT451906	hsa-miR-4271	PAR-CLIP	23592263
MIRT451905	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT451904	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT006720	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT451903	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT451902	hsa-miR-5698	PAR-CLIP	23592263
MIRT451901	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT451900	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT451899	hsa-miR-4525	PAR-CLIP	23592263
MIRT451898	hsa-miR-5010-5p	PAR-CLIP	23592263
MIRT451897	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT451896	hsa-miR-6842-3p	PAR-CLIP	23592263
MIRT451895	hsa-miR-1275	PAR-CLIP	23592263
MIRT451894	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT1065583	hsa-miR-31	CLIP-seq
MIRT1065584	hsa-miR-3688-5p	CLIP-seq
MIRT1065585	hsa-miR-4504	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq
MIRT2551684	hsa-miR-1225-3p	CLIP-seq
MIRT2551685	hsa-miR-1233	CLIP-seq
MIRT2551686	hsa-miR-128	CLIP-seq
MIRT2551687	hsa-miR-1908	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT2551688	hsa-miR-3612	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT2551689	hsa-miR-3921	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT2551690	hsa-miR-4303	CLIP-seq
MIRT2551691	hsa-miR-4443	CLIP-seq
MIRT2551692	hsa-miR-4536	CLIP-seq
MIRT2551693	hsa-miR-4653-5p	CLIP-seq
MIRT2551694	hsa-miR-4707-3p	CLIP-seq
MIRT2551695	hsa-miR-4749-3p	CLIP-seq
MIRT2551696	hsa-miR-625	CLIP-seq
MIRT2551697	hsa-miR-635	CLIP-seq
MIRT2551698	hsa-miR-650	CLIP-seq
MIRT2551699	hsa-miR-663	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq
MIRT2551684	hsa-miR-1225-3p	CLIP-seq
MIRT2551685	hsa-miR-1233	CLIP-seq
MIRT2551686	hsa-miR-128	CLIP-seq
MIRT2551687	hsa-miR-1908	CLIP-seq
MIRT1065586	hsa-miR-2110	CLIP-seq
MIRT1065587	hsa-miR-3150a-3p	CLIP-seq
MIRT1065588	hsa-miR-3175	CLIP-seq
MIRT2551688	hsa-miR-3612	CLIP-seq
MIRT2682818	hsa-miR-361-3p	CLIP-seq
MIRT2682819	hsa-miR-3679-3p	CLIP-seq
MIRT1065589	hsa-miR-3689d	CLIP-seq
MIRT1065590	hsa-miR-370	CLIP-seq
MIRT2551689	hsa-miR-3921	CLIP-seq
MIRT1065591	hsa-miR-4260	CLIP-seq
MIRT2551690	hsa-miR-4303	CLIP-seq
MIRT2551691	hsa-miR-4443	CLIP-seq
MIRT2551692	hsa-miR-4536	CLIP-seq
MIRT2551693	hsa-miR-4653-5p	CLIP-seq
MIRT2551694	hsa-miR-4707-3p	CLIP-seq
MIRT2551695	hsa-miR-4749-3p	CLIP-seq
MIRT2551696	hsa-miR-625	CLIP-seq
MIRT2551697	hsa-miR-635	CLIP-seq
MIRT2551698	hsa-miR-650	CLIP-seq
MIRT2551699	hsa-miR-663	CLIP-seq
MIRT1065592	hsa-miR-939	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
ERG	Repression	23027626
TWIST1	Repression	19051271
TWIST2	Repression	19051271

Show/Hide all(73)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IDA	20005845
GO:0000785	Component	Chromatin	IDA	17420447
GO:0000902	Process	Cell morphogenesis	IMP	30254023
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	20005845, 21524996
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005178	Function	Integrin binding	IDA	20005845
GO:0005515	Function	Protein binding	IPI	11331308, 11331582, 12432066, 15817463, 16189514, 16936772, 17003112, 17553790, 18339839, 19074270, 20005845, 20926685, 21516116, 21643011, 22939624, 23414517, 23455922, 23877428, 25416956, 25502805, 25852190, 26496610, 26972000, 28514442, 30254023, 31515488, 32296183, 32707033, 339
GO:0005524	Function	ATP binding	IDA	20005845, 21524996
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	17420447
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17420447
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	18283114
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IBA
GO:0005925	Component	Focal adhesion	IDA	30254023
GO:0005925	Component	Focal adhesion	IEA
GO:0005938	Component	Cell cortex	IEA
GO:0007052	Process	Mitotic spindle organization	IMP	18283114
GO:0007160	Process	Cell-matrix adhesion	IBA
GO:0007160	Process	Cell-matrix adhesion	TAS	8538749
GO:0007229	Process	Integrin-mediated signaling pathway	IBA
GO:0007229	Process	Integrin-mediated signaling pathway	IDA	9366252
GO:0007229	Process	Integrin-mediated signaling pathway	IEA
GO:0007229	Process	Integrin-mediated signaling pathway	ISS	20675382
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009653	Process	Anatomical structure morphogenesis	IEA
GO:0009967	Process	Positive regulation of signal transduction	IMP	10637513
GO:0010761	Process	Fibroblast migration	IEA
GO:0014044	Process	Schwann cell development	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	19118217
GO:0021675	Process	Nerve development	IEA
GO:0022011	Process	Myelination in peripheral nervous system	IEA
GO:0030017	Component	Sarcomere	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030154	Process	Cell differentiation	IBA
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IBA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IMP	21343177
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IBA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	19118217
GO:0042995	Component	Cell projection	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	21343177
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	20018240
GO:0046872	Function	Metal ion binding	IEA
GO:0061351	Process	Neural precursor cell proliferation	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070527	Process	Platelet aggregation	HMP	23382103
GO:0070836	Process	Caveola assembly	IEA
GO:0072697	Process	Protein localization to cell cortex	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	20018240
GO:1900026	Process	Positive regulation of substrate adhesion-dependent cell spreading	IGI	30254023
GO:2000178	Process	Negative regulation of neural precursor cell proliferation	IEA

MIM	HGNC	e!Ensembl
602366	6040	ENSG00000166333

Protein

UniProt ID

Q13418

Protein name

Scaffold protein ILK (ILK-1) (ILK-2) (Inactive integrin-linked kinase) (p59ILK)

Protein function

Scaffold protein which mediates protein-protein interactions during a range of cellular events including focal adhesion assembly, cell adhesion and cell migration (PubMed:17420447, PubMed:20005845, PubMed:30367047, PubMed:32528174). Regulates in

PDB

2KBX , 3F6Q , 3IXE , 3KMU , 3KMW , 3REP , 4HI8 , 4HI9 , 6MIB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13857	Ank_5	60 → 107		Repeat
PF12796	Ank_2	63 → 130	Ankyrin repeats (3 copies)	Repeat
PF07714	PK_Tyr_Ser-Thr	193 → 446	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart followed by skeletal muscle, pancreas and kidney. Weakly expressed in placenta, lung and liver.

Sequence

MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Sequence length

452

Interactions

View interactions

	KEGG		Reactome
	PPAR signaling pathway Axon guidance Focal adhesion Bacterial invasion of epithelial cells Shigellosis Endometrial cancer		Localization of the PINCH-ILK-PARVIN complex to focal adhesions Cell-extracellular matrix interactions

Show/Hide Unknown Diseases (6)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
cardiomyopathy	Cardiomyopathy	N/A	N/A	ClinVar
Cardiomyopathy	Primary dilated cardiomyopathy	N/A	N/A	ClinVar
Gastric Cancer	Gastric cancer	ILK and EGFR inhibitors increase sensitivity to AZD4547 in FGFR2 amplified gastric cancer cells	31076567	CBGDA
Hypertrophic Cardiomyopathy	Primary familial hypertrophic cardiomyopathy	N/A	N/A	ClinVar
Long QT Syndrome	long qt syndrome	N/A	N/A	ClinVar
Myopathy	dilated cardiomyopathy	N/A	N/A	GenCC

Show/Hide Text Mining Associations (79)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	23065574
Adenomatous Polyposis Coli	Associate	12771992
Adenomyosis	Associate	29409901
Arrhythmogenic Right Ventricular Dysplasia	Associate	31843279
Astrocytoma	Associate	26286747
Breast Neoplasms	Associate	23832543, 26905583, 27391337, 31296919, 31785406
Capsule Opacification	Associate	30332398
Carcinogenesis	Associate	18436335, 18722108, 21719054, 23784942
Carcinogenesis	Inhibit	32315343
Carcinoma Endometrioid	Associate	30907484
Carcinoma Hepatocellular	Associate	29152644
Carcinoma Non Small Cell Lung	Associate	15631637, 19147542, 23801886, 25964055, 30473379, 36827714
Carcinoma Ovarian Epithelial	Associate	26959113, 28097141
Carcinoma Renal Cell	Associate	22814720, 27279483
Carcinoma Squamous Cell	Associate	23065574, 37746966
Cardiomyopathies	Associate	29030401
Chondrosarcoma	Associate	18722108
Choroidal Effusions	Associate	23099104
Clear cell metastatic renal cell carcinoma	Associate	27279483
Colorectal Neoplasms	Associate	12771992, 27099440, 29496692, 34249475, 36510452
Colorectal Neoplasms	Inhibit	35429970
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	29309923
Dementia Multi Infarct	Associate	23317227
Diabetic Cardiomyopathies	Associate	35571621
Diabetic Nephropathies	Associate	21752957, 23037158
Ehlers Danlos Syndrome	Associate	29309923
Ehlers Danlos syndrome type 3	Associate	29309923
Endometrial Neoplasms	Associate	32315343, 36768775
Endometrial Stromal Tumors	Associate	32982173
Endometriosis	Associate	30182767
Endometriosis	Stimulate	36768775
Esophageal Squamous Cell Carcinoma	Associate	35587162
Farber Lipogranulomatosis	Associate	23065574
Fetal Growth Retardation	Stimulate	19483473
Gallbladder Neoplasms	Associate	23065574
Glaucoma	Associate	27315599
Glioblastoma	Associate	26176204, 26460618
Glycosuria Renal	Associate	24040439
Hypoxia	Associate	29656700
Hypoxia Brain	Stimulate	24347249
Hypoxia Brain	Associate	29656700
Inflammation	Associate	35571621, 35778385
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	32413332
Leukemia Myeloid Acute	Associate	35485671
Liver Cirrhosis	Associate	29786754
Lung Neoplasms	Associate	19147542, 23801886, 25760437
Lymphatic Metastasis	Associate	15631637, 23832543, 25964055, 30575914
Lymphatic Metastasis	Stimulate	23065574
Malignant mesenchymal tumor	Stimulate	34249475
Melanoma	Associate	24157826, 32305668
Mesothelioma Malignant	Associate	19781955
Mouth Diseases	Associate	36768775
Multiple Myeloma	Associate	29656700
Neoplasm Metastasis	Associate	22814720, 23317227, 27099440, 27315599, 29496692, 34455760, 36827714
Neoplasm Metastasis	Stimulate	23784942, 32315343
Neoplasms	Associate	12771992, 15631637, 17383746, 18436335, 18722108, 22814720, 23099104, 25450398, 25760437, 25964055, 26176204, 27315599, 28893556, 29152644, 29496692 View all (13 more)
Neoplasms	Inhibit	20460506
Neoplasms	Stimulate	23065574, 27683053
Neoplasms Glandular and Epithelial	Associate	23784942
Neoplasms Squamous Cell	Associate	29914539, 33347497
Neuroblastoma	Associate	21719054, 29695398
Optic Nerve Hypoplasia	Stimulate	36423879
Osteoarthritis	Stimulate	23237804
Osteosarcoma	Associate	23784942
Ovarian Hyperstimulation Syndrome	Associate	32945993
Ovarian Neoplasms	Associate	23099104, 26959113, 28944870, 35379775
Pancreatic Neoplasms	Associate	15867245, 23764046, 27936345, 37477162
Pre Eclampsia	Inhibit	24564279
Prostatic Neoplasms	Associate	10716737, 24497940
Prostatic Neoplasms	Stimulate	12771992
Radiation Injuries	Associate	25961636
Retinal Neoplasms	Stimulate	24911651
Retinoblastoma	Associate	24911651, 26176204
Sarcoma Ewing	Stimulate	12771992
Squamous Cell Carcinoma of Head and Neck	Associate	30575914
Stomach Neoplasms	Associate	16987993, 23317227, 35778385
Thyroid Neoplasms	Associate	26549818
Urinary Bladder Neoplasms	Associate	27683053, 35039759, 39508245
Venous Thromboembolism	Associate	34381164

ILK (integrin linked kinase)