Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3609
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin enhancer binding factor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ILF3
Synonyms (NCBI Gene) Gene synonyms aliases
CBTF, DRBF, DRBP76, MMP4, MPHOSPH4, MPP4, MPP4110, NF-AT-90, NF110, NF110b, NF90, NF90a, NF90b, NF90c, NF90ctv, NFAR, NFAR-1, NFAR-2, NFAR110, NFAR2, NFAR90, TCP110, TCP80
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein (NF90, ILF3) forms a heterodimer with a 45 kDa transc
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT025730 hsa-miR-7-5p Microarray 19073608
MIRT050983 hsa-miR-17-5p CLASH 23622248
MIRT045490 hsa-miR-149-5p CLASH 23622248
MIRT045018 hsa-miR-186-5p CLASH 23622248
MIRT045018 hsa-miR-186-5p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
ILF2 Unknown 11739746
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001618 Function Virus receptor activity IDA 21123651
GO:0003677 Function DNA binding IDA 7519613, 10574923
GO:0003677 Function DNA binding IEA
GO:0003723 Function RNA binding HDA 22658674, 22681889
GO:0003723 Function RNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603182 6038 ENSG00000129351
Protein
UniProt ID Q12906
Protein name Interleukin enhancer-binding factor 3 (Double-stranded RNA-binding protein 76) (DRBP76) (M-phase phosphoprotein 4) (MPP4) (Nuclear factor associated with dsRNA) (NFAR) (Nuclear factor of activated T-cells 90 kDa) (NF-AT-90) (Translational control protein
Protein function RNA-binding protein that plays an essential role in the biogenesis of circular RNAs (circRNAs) which are produced by back-splicing circularization of pre-mRNAs. Within the nucleus, promotes circRNAs processing by stabilizing the regulatory eleme
PDB 2L33 , 3P1X , 7RJM , 7RJQ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07528 DZF 94 342 DZF domain Domain
PF00035 dsrm 402 465 Double-stranded RNA binding motif Domain
PF00035 dsrm 526 588 Double-stranded RNA binding motif Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQA
ESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKP
TTALLDKVADNLAIQLAAVTEDKYEILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEM
EKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGLKSCVIVIRVLRDLCTRV
PTWGPLRGWPLELLCEKSIGTANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEAT
DAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGMDPLPSK
MPKKPKNENPVDYTVQIP
PSTTYAITPMKRPMEEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKPGLQYKL
VSQTGPVHAPIFTMSVEVDGNSFEASGPSKKTAKLHVAVKVLQDM
GLPTGAEGRDSSKGE
DSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAEQGPILTKHGKNPVMELNEKRRGLK
YELISETGGSHDKRFVMEVEVDGQKFQGAGSNKKVAKAYAALAALEKL
FPDTPLALDANK
KKRAPVPVRGGPKFAAKPHNPGFGMGGPMHNEVPPPPNLRGRGRGGSIRGRGRGRGFGGA
NHGGYMNAGAGYGSYGYGGNSATAGYSQFYSNGGHSGNASGGGGGGGGGSSGYGSYYQGD
NYNSPVPPKHAGKKQPHGGQQKPSYGSGYQSHQGQQQSYNQSPYSNYGPPQGKQKGYNHG
QGSYSYSNSYNSPGGGGGSDYNYESKFNYSGSGGRSGGNSYGSGGASYNPGSHGGYGGGS
GGGSSYQGKQGGYSQSNYNSPGSGQNYSGPPSSYQSSQGGYGRNADHSMNYQYR
Sequence length 894
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar I disorder N/A N/A GWAS
Ischemic Stroke Ischemic stroke N/A N/A GWAS
Myocardial Infarction Myocardial infarction N/A N/A GWAS
Rheumatoid arthritis Rheumatoid arthritis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Stimulate 27814385
Adenocarcinoma of Lung Associate 19088038
Breast Neoplasms Associate 24160375, 26273641, 35579257
Carcinogenesis Associate 27110706
Carcinoma Hepatocellular Associate 27519414, 37301543, 38072045, 40264052
Carcinoma Non Small Cell Lung Associate 37705754
Cardiovascular Diseases Associate 33885378
Colorectal Neoplasms Associate 32248186
Coronary Artery Disease Associate 26908601
COVID 19 Associate 35013429