Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3606
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 18
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL18
Synonyms (NCBI Gene) Gene synonyms aliases
IGIF, IL-18, IL-1g, IL1F4
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004304 hsa-miR-346 qRT-PCR, Luciferase reporter assay, Western blot, Northern blot 19342689
MIRT054556 hsa-miR-197-3p Microarray, qRT-PCR 23710316
MIRT438748 hsa-miR-130a-3p ELISA, Luciferase reporter assay, qRT-PCR 24801815
MIRT438748 hsa-miR-130a-3p ELISA, Luciferase reporter assay, qRT-PCR 24801815
MIRT1064132 hsa-miR-129-5p CLIP-seq
Transcription factors
Transcription factor Regulation Reference
HDAC9 Unknown 11944905
NFKB1 Activation 15963597;17399992
NFKB1 Unknown 10227974
RELA Activation 15963597;17399992
RELA Unknown 10227974
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IDA 11466388
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IDA 14528293, 25500532
GO:0005125 Function Cytokine activity IEA
GO:0005125 Function Cytokine activity ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600953 5986 ENSG00000150782
Protein
UniProt ID Q14116
Protein name Interleukin-18 (IL-18) (Iboctadekin) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)
Protein function Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses (PubMed:10653850). Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex whi
PDB 1J0S , 2VXT , 3F62 , 3WO2 , 3WO3 , 3WO4 , 4EEE , 4EKX , 4HJJ , 4R6U , 4XFS , 4XFT , 4XFU , 7AL7 , 8J6K , 8SPB , 8SV1 , 8URV
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00340 IL1 72 185 Interleukin-1 / 18 Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 2]: Expressed in ovarian carcinoma but undetectable in normal ovarian epithelial cells. Resistant to proteolytic activation by caspase-1 and -4. {ECO:0000269|PubMed:15326478}.
Sequence
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSI
MFTVQNED
Sequence length 193
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
NOD-like receptor signaling pathway
Cytosolic DNA-sensing pathway
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Legionellosis
Yersinia infection
African trypanosomiasis
Malaria
Tuberculosis
Influenza A
Inflammatory bowel disease
Rheumatoid arthritis
Lipid and atherosclerosis
  Interleukin-1 processing
Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Interleukin-18 signaling
Purinergic signaling in leishmaniasis infection
<