Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3606
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 18
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL18
Synonyms (NCBI Gene) Gene synonyms aliases	IGIF, IL-18, IL-1g, IL1F4
Chromosome Chromosome number	11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	11q23.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a proinflammatory cytokine of the IL-1 family that is constitutively found as a precursor within the cytoplasm of a variety of cells including macrophages and keratinocytes. The inactive IL-18 precursor is processed to

Show/Hide all(41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004304	hsa-miR-346	qRT-PCR, Luciferase reporter assay, Western blot, Northern blot	19342689
MIRT054556	hsa-miR-197-3p	Microarray, qRT-PCR	23710316
MIRT438748	hsa-miR-130a-3p	ELISA, Luciferase reporter assay, qRT-PCR	24801815
MIRT438748	hsa-miR-130a-3p	ELISA, Luciferase reporter assay, qRT-PCR	24801815
MIRT1064132	hsa-miR-129-5p	CLIP-seq
MIRT1064133	hsa-miR-4252	CLIP-seq
MIRT1064134	hsa-miR-4304	CLIP-seq
MIRT1064135	hsa-miR-4438	CLIP-seq
MIRT1064136	hsa-miR-5095	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2247554	hsa-miR-143	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2247555	hsa-miR-3149	CLIP-seq
MIRT2247556	hsa-miR-3155	CLIP-seq
MIRT2247557	hsa-miR-3155b	CLIP-seq
MIRT2247558	hsa-miR-3663-5p	CLIP-seq
MIRT2247559	hsa-miR-411	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2247560	hsa-miR-4635	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq
MIRT2247561	hsa-miR-4716-5p	CLIP-seq
MIRT2247562	hsa-miR-4770	CLIP-seq
MIRT2247563	hsa-miR-4781-3p	CLIP-seq
MIRT2247564	hsa-miR-484	CLIP-seq
MIRT2247565	hsa-miR-5096	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq
MIRT2015262	hsa-miR-1307	CLIP-seq
MIRT2015263	hsa-miR-197	CLIP-seq
MIRT2015264	hsa-miR-4284	CLIP-seq
MIRT2015265	hsa-miR-4638-5p	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
HDAC9	Unknown	11944905
NFKB1	Activation	15963597;17399992
NFKB1	Unknown	10227974
RELA	Activation	15963597;17399992
RELA	Unknown	10227974
SPI1	Unknown	14991611

Show/Hide all(76)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IDA	11466388
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	14528293, 25500532
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	ISS
GO:0005125	Function	Cytokine activity	TAS	8666798, 11598150
GO:0005515	Function	Protein binding	IPI	19104048, 25261253, 28514442, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	11598150
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	33883744, 37993712, 37993714
GO:0005615	Component	Extracellular space	IDA	21323571
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9792649
GO:0008283	Process	Cell population proliferation	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	IEA
GO:0010744	Process	Positive regulation of macrophage derived foam cell differentiation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0030101	Process	Natural killer cell activation	IEA
GO:0030155	Process	Regulation of cell adhesion	IDA	11477102
GO:0030431	Process	Sleep	ISS	11506998
GO:0032722	Process	Positive regulation of chemokine production	TAS	11598150
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	10653850, 14528293, 19088061, 20027291
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	TAS	10227975
GO:0032736	Process	Positive regulation of interleukin-13 production	TAS	10227975
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IDA	14528293, 21321938, 25500532, 37993714
GO:0035655	Process	Interleukin-18-mediated signaling pathway	IEA
GO:0042088	Process	T-helper 1 type immune response	IDA	8766574
GO:0042092	Process	Type 2 immune response	TAS	11905033
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	8766574
GO:0042119	Process	Neutrophil activation	IEA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042531	Process	Positive regulation of tyrosine phosphorylation of STAT protein	IDA	10903731
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0045515	Function	Interleukin-18 receptor binding	IDA	14528293, 25500532, 37993714
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	IEA
GO:0045630	Process	Positive regulation of T-helper 2 cell differentiation	ISS
GO:0045662	Process	Negative regulation of myoblast differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	24615654
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	21321938
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	ISS
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	25500532
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	21321938
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061436	Process	Establishment of skin barrier	ISS
GO:0070328	Process	Triglyceride homeostasis	IEA
GO:0070328	Process	Triglyceride homeostasis	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	26656097
GO:0150078	Process	Positive regulation of neuroinflammatory response	TAS	26753638
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IDA	10653850

MIM	HGNC	e!Ensembl
600953	5986	ENSG00000150782

Protein

UniProt ID

Q14116

Protein name

Interleukin-18 (IL-18) (Iboctadekin) (Interferon gamma-inducing factor) (IFN-gamma-inducing factor) (Interleukin-1 gamma) (IL-1 gamma)

Protein function

Pro-inflammatory cytokine primarily involved in epithelial barrier repair, polarized T-helper 1 (Th1) cell and natural killer (NK) cell immune responses (PubMed:10653850). Upon binding to IL18R1 and IL18RAP, forms a signaling ternary complex whi

PDB

1J0S , 2VXT , 3F62 , 3WO2 , 3WO3 , 3WO4 , 4EEE , 4EKX , 4HJJ , 4R6U , 4XFS , 4XFT , 4XFU , 7AL7 , 8J6K , 8SPB , 8SV1 , 8URV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00340	IL1	72 → 185	Interleukin-1 / 18	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 2]: Expressed in ovarian carcinoma but undetectable in normal ovarian epithelial cells. Resistant to proteolytic activation by caspase-1 and -4. {ECO:0000269|PubMed:15326478}.

Sequence

MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED

Sequence length

193

Interactions

View interactions

IL18 (interleukin 18)