Gene Gene information from NCBI Gene database.
Entrez ID 3605
Gene name Interleukin 17A
Gene symbol IL17A
Synonyms (NCBI Gene)
CTLA-8CTLA8IL-17IL-17AIL17ILA17
Chromosome 6
Chromosome location 6p12.2
Summary This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molec
miRNA miRNA information provided by mirtarbase database.
13
miRTarBase ID miRNA Experiments Reference
MIRT016706 hsa-miR-335-5p Microarray 18185580
MIRT734534 hsa-miR-122-3p ELISALuciferase reporter assay 33230454
MIRT734536 hsa-miR-30a-3p ELISALuciferase reporter assay 33230454
MIRT735527 hsa-miR-126-5p Flow cytometryLuciferase reporter assayqRT-PCRWestern blotting 33365067
MIRT1063794 hsa-miR-1236 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
HDAC11 Repression 21239696
NFKB1 Unknown 21243522
RELA Unknown 21243522
RORC Unknown 19578368
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
60
GO ID Ontology Definition Evidence Reference
GO:0002225 Process Positive regulation of antimicrobial peptide production IEA
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
GO:0005125 Function Cytokine activity IDA 12297109, 22727489
GO:0005125 Function Cytokine activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603149 5981 ENSG00000112115
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16552
Protein name Interleukin-17A (IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)
Protein function Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed:24120361). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL
PDB 2VXS , 4HR9 , 4HSA , 4QHU , 5HHV , 5HHX , 5HI3 , 5HI4 , 5HI5 , 5N7W , 5N92 , 5NAN , 5VB9 , 6WIO , 6WIR , 7AMA , 7AMG , 7UWM , 7UWN , 7WKX , 7Z2M , 7ZAN , 8B7W , 8CDG , 8DY1 , 8DY5 , 8DYF , 8DYG , 8DYH , 8DYI , 8USR , 8USS , 9FKX , 9FL3 , 9H4D , 9H4O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06083 IL17 69 147 Interleukin-17 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in memory Th17 cells (at protein level). {ECO:0000269|PubMed:17763419}.
Sequence
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCV
TPIVHHVA
Sequence length 155
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
IL-17 signaling pathway
Th17 cell differentiation
Alcoholic liver disease
Inflammatory bowel disease
Rheumatoid arthritis
  Interleukin-17 signaling
Interleukin-4 and Interleukin-13 signaling