IL17A (interleukin 17A)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3605
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 17A
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL17A
Synonyms (NCBI Gene) Gene synonyms aliases
CTLA-8, CTLA8, IL-17, IL-17A, IL17, ILA17
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p12.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the IL-17 receptor family which includes five members (IL-17RA-E) and the encoded protein is a proinflammatory cytokine produced by activated T cells. IL-17A-mediated downstream pathways induce the production of inflammatory molec
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT016706 hsa-miR-335-5p Microarray 18185580
MIRT734534 hsa-miR-122-3p ELISA, Luciferase reporter assay 33230454
MIRT734536 hsa-miR-30a-3p ELISA, Luciferase reporter assay 33230454
MIRT735527 hsa-miR-126-5p Flow cytometry, Luciferase reporter assay, qRT-PCR, Western blotting 33365067
MIRT1063794 hsa-miR-1236 CLIP-seq
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(4)
Transcription factor Regulation Reference
HDAC11 Repression 21239696
NFKB1 Unknown 21243522
RELA Unknown 21243522
RORC Unknown 19578368
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(36)
GO ID Ontology Definition Evidence Reference
GO:0002225 Process Positive regulation of antimicrobial peptide production IEA
GO:0002250 Process Adaptive immune response IEA
GO:0005125 Function Cytokine activity IEA
GO:0005515 Function Protein binding IPI 23695682, 25416956, 28827714, 32296183
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
603149 5981 ENSG00000112115
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q16552
Protein name Interleukin-17A (IL-17) (IL-17A) (Cytotoxic T-lymphocyte-associated antigen 8) (CTLA-8)
Protein function Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity (PubMed:24120361). Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL
PDB 2VXS , 4HR9 , 4HSA , 4QHU , 5HHV , 5HHX , 5HI3 , 5HI4 , 5HI5 , 5N7W , 5N92 , 5NAN , 5VB9 , 6WIO , 6WIR , 7AMA , 7AMG , 7UWM , 7UWN , 7WKX , 7Z2M , 7ZAN , 8B7W , 8CDG , 8DY1 , 8DY5 , 8DYF , 8DYG , 8DYH , 8DYI , 8USR , 8USS , 9FKX , 9FL3 , 9H4D , 9H4O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06083 IL17 69 → 147 Interleukin-17 Family
Tissue specificity TISSUE SPECIFICITY: Expressed in memory Th17 cells (at protein level). {ECO:0000269|PubMed:17763419}.
Sequence 
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNP
KRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEIL
VLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Sequence length 155
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
IL-17 signaling pathway
Th17 cell differentiation
Alcoholic liver disease
Inflammatory bowel disease
Rheumatoid arthritis 		  Interleukin-17 signaling
Interleukin-4 and Interleukin-13 signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (5)
Causal
Disease term Disease name dbSNP ID References
Arthritis Arthritis rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Autoimmune diseases Autoimmune Diseases rs869025224 21227906
Lymphoproliferative disorder Lymphoproliferative Disorders rs121908191, rs398122933, rs397514667, rs397514260, rs397514261, rs748418658, rs781593353 22617429
Multiple sclerosis Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039
View all (4 more)		 23517930
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Non-obstructive azoospermia Non-obstructive azoospermia GWAS
Show/Hide Text Mining Associations (759)
Associations from Text Mining
Disease Name Relationship Type References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency Associate 18362907
Abortion Habitual Associate 24975966
Abortion Spontaneous Stimulate 33731680
Abortion Spontaneous Associate 36096448
Acne Vulgaris Associate 23924903, 25153527, 37933032
Acquired Immunodeficiency Syndrome Stimulate 35720334
Acute Coronary Syndrome Associate 21804579, 22711477
Acute Disease Associate 22028838
Acute Kidney Injury Stimulate 33348065
Acute Kidney Injury Associate 39696008