Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3603
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 16
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL16
Synonyms (NCBI Gene) Gene synonyms aliases	LCF, NIL16, PRIL16, prIL-16
Chromosome Chromosome number	15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	15q25.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. The signaling process of this cytokine is mediated by CD4. The product of this gene unde

Show/Hide all(100)

miRTarBase ID	miRNA	Experiments
MIRT1063750	hsa-miR-1285	CLIP-seq
MIRT1063751	hsa-miR-3187-5p	CLIP-seq
MIRT1063752	hsa-miR-4252	CLIP-seq
MIRT1063753	hsa-miR-4646-5p	CLIP-seq
MIRT1063754	hsa-miR-4691-3p	CLIP-seq
MIRT1063755	hsa-miR-4747-5p	CLIP-seq
MIRT1063756	hsa-miR-612	CLIP-seq
MIRT1063757	hsa-miR-671-5p	CLIP-seq
MIRT1063758	hsa-miR-101	CLIP-seq
MIRT1063759	hsa-miR-1207-3p	CLIP-seq
MIRT1063760	hsa-miR-134	CLIP-seq
MIRT1063761	hsa-miR-144	CLIP-seq
MIRT1063762	hsa-miR-1827	CLIP-seq
MIRT1063763	hsa-miR-1913	CLIP-seq
MIRT1063764	hsa-miR-199a-5p	CLIP-seq
MIRT1063765	hsa-miR-199b-5p	CLIP-seq
MIRT1063766	hsa-miR-22	CLIP-seq
MIRT1063767	hsa-miR-223	CLIP-seq
MIRT1063768	hsa-miR-2909	CLIP-seq
MIRT1063769	hsa-miR-3118	CLIP-seq
MIRT1063770	hsa-miR-3149	CLIP-seq
MIRT1063771	hsa-miR-3162-5p	CLIP-seq
MIRT1063772	hsa-miR-3164	CLIP-seq
MIRT1063773	hsa-miR-324-3p	CLIP-seq
MIRT1063774	hsa-miR-3612	CLIP-seq
MIRT1063775	hsa-miR-3622a-3p	CLIP-seq
MIRT1063776	hsa-miR-3622b-3p	CLIP-seq
MIRT1063777	hsa-miR-425	CLIP-seq
MIRT1063752	hsa-miR-4252	CLIP-seq
MIRT1063778	hsa-miR-4313	CLIP-seq
MIRT1063779	hsa-miR-4443	CLIP-seq
MIRT1063780	hsa-miR-4493	CLIP-seq
MIRT1063781	hsa-miR-4520a-5p	CLIP-seq
MIRT1063782	hsa-miR-4520b-5p	CLIP-seq
MIRT1063783	hsa-miR-4697-3p	CLIP-seq
MIRT1063784	hsa-miR-4717-5p	CLIP-seq
MIRT1063755	hsa-miR-4747-5p	CLIP-seq
MIRT1063785	hsa-miR-4753-5p	CLIP-seq
MIRT1063786	hsa-miR-4802-5p	CLIP-seq
MIRT1063787	hsa-miR-490-3p	CLIP-seq
MIRT1063788	hsa-miR-582-5p	CLIP-seq
MIRT1063789	hsa-miR-642b	CLIP-seq
MIRT1063790	hsa-miR-649	CLIP-seq
MIRT1063791	hsa-miR-650	CLIP-seq
MIRT1063792	hsa-miR-935	CLIP-seq
MIRT1063793	hsa-miR-940	CLIP-seq
MIRT1063784	hsa-miR-4717-5p	CLIP-seq
MIRT2015107	hsa-miR-1972	CLIP-seq
MIRT2015108	hsa-miR-3183	CLIP-seq
MIRT2015109	hsa-miR-3190	CLIP-seq
MIRT2015110	hsa-miR-3202	CLIP-seq
MIRT2015111	hsa-miR-339-5p	CLIP-seq
MIRT2015112	hsa-miR-3921	CLIP-seq
MIRT2015113	hsa-miR-4290	CLIP-seq
MIRT2015114	hsa-miR-4480	CLIP-seq
MIRT2015115	hsa-miR-4533	CLIP-seq
MIRT2015116	hsa-miR-4653-5p	CLIP-seq
MIRT2015117	hsa-miR-4662a-5p	CLIP-seq
MIRT2015118	hsa-miR-4723-3p	CLIP-seq
MIRT1063755	hsa-miR-4747-5p	CLIP-seq
MIRT2015119	hsa-miR-4763-5p	CLIP-seq
MIRT2247393	hsa-miR-1271	CLIP-seq
MIRT2247394	hsa-miR-4435	CLIP-seq
MIRT2247395	hsa-miR-4645-5p	CLIP-seq
MIRT2247396	hsa-miR-4673	CLIP-seq
MIRT2247397	hsa-miR-4755-3p	CLIP-seq
MIRT2247398	hsa-miR-96	CLIP-seq
MIRT1063750	hsa-miR-1285	CLIP-seq
MIRT1063751	hsa-miR-3187-5p	CLIP-seq
MIRT1063752	hsa-miR-4252	CLIP-seq
MIRT1063753	hsa-miR-4646-5p	CLIP-seq
MIRT1063754	hsa-miR-4691-3p	CLIP-seq
MIRT1063755	hsa-miR-4747-5p	CLIP-seq
MIRT1063756	hsa-miR-612	CLIP-seq
MIRT1063757	hsa-miR-671-5p	CLIP-seq
MIRT2389345	hsa-miR-3679-3p	CLIP-seq
MIRT2429983	hsa-miR-125a-3p	CLIP-seq
MIRT2015107	hsa-miR-1972	CLIP-seq
MIRT2429984	hsa-miR-4323	CLIP-seq
MIRT2429985	hsa-miR-4530	CLIP-seq
MIRT2429986	hsa-miR-4650-5p	CLIP-seq
MIRT2429987	hsa-miR-4726-3p	CLIP-seq
MIRT2451703	hsa-miR-4485	CLIP-seq
MIRT2451704	hsa-miR-95	CLIP-seq
MIRT2465475	hsa-miR-1245b-5p	CLIP-seq
MIRT2465476	hsa-miR-15a	CLIP-seq
MIRT2465477	hsa-miR-15b	CLIP-seq
MIRT2465478	hsa-miR-16	CLIP-seq
MIRT2465479	hsa-miR-195	CLIP-seq
MIRT2465480	hsa-miR-3064-5p	CLIP-seq
MIRT2465481	hsa-miR-3142	CLIP-seq
MIRT2465482	hsa-miR-424	CLIP-seq
MIRT2465483	hsa-miR-4524	CLIP-seq
MIRT2465484	hsa-miR-497	CLIP-seq
MIRT2465485	hsa-miR-503	CLIP-seq
MIRT2465486	hsa-miR-646	CLIP-seq
MIRT2682760	hsa-miR-1224-3p	CLIP-seq
MIRT2682761	hsa-miR-145	CLIP-seq
MIRT2015111	hsa-miR-339-5p	CLIP-seq
MIRT2682762	hsa-miR-4286	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	9144227
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0005925	Component	Focal adhesion	IDA
GO:0006935	Process	Chemotaxis	IEA
GO:0006955	Process	Immune response	TAS	9144227
GO:0016607	Component	Nuclear speck	IDA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	ISS	30089723
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0032730	Process	Positive regulation of interleukin-1 alpha production	IDA	30634164
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	30634164
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	30634164
GO:0042609	Function	CD4 receptor binding	IBA
GO:0042609	Function	CD4 receptor binding	IPI	24942581
GO:0050729	Process	Positive regulation of inflammatory response	IBA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	30634164
GO:0050930	Process	Induction of positive chemotaxis	IEA
GO:0050930	Process	Induction of positive chemotaxis	IEA
GO:0051924	Process	Regulation of calcium ion transport	IDA	24942581
GO:0090543	Component	Flemming body	IDA
GO:1902565	Process	Positive regulation of neutrophil activation	ISS	30089723

MIM	HGNC	e!Ensembl
603035	5980	ENSG00000172349

Protein

UniProt ID

Q14005

Protein name

Pro-interleukin-16 [Cleaved into: Interleukin-16 (IL-16) (Lymphocyte chemoattractant factor) (LCF)]

Protein function

Interleukin-16 stimulates a migratory response in CD4+ lymphocytes, monocytes, and eosinophils. Primes CD4+ T-cells for IL-2 and IL-15 responsiveness. Also induces T-lymphocyte expression of interleukin 2 receptor. Ligand for CD4.; [Is

PDB

1I16 , 1X6D , 5FB8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00595	PDZ	216 → 300	PDZ domain	Domain
PF00595	PDZ	1113 → 1195	PDZ domain	Domain
PF00595	PDZ	1234 → 1317	PDZ domain	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 3]: Expressed in hemopoietic tissues, such as resting T-cells, but undetectable during active T-cell proliferation.

Sequence

MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSS
VQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEA
QSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQL
DCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYG
PIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTHQDALQKFKQAKKGLLTLTVR
TRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNYRIMVEVSLQK
EAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE
VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLES
SWHGRPTLEKEREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDIS
THSPSLPLAREPVVLSIASSRLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPP
PRKYFKSDSDPQKSLEERENSSCSSGHTPPTCGQEARELLPLLLPQEDTAGRSPSASAGC
PGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDC
IKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKVYKSADSSTVK
KGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR
QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQP
EQVLSSGSPAASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMP
SQRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKE
GASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDGDHSSLQSGQS
VISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVIT
VHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTP
EAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKP
LTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKS
LQSKETTAAGDS

Sequence length

1332

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction		Other interleukin signaling

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Biliary Cholangitis	Primary biliary cholangitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (123)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	30587197, 30671474
Alzheimer Disease	Associate	30193587
Arthritis Rheumatoid	Associate	18446062, 19279017, 22355377
Arthritis Rheumatoid	Stimulate	9754554
Asthma	Associate	10809960, 17303923, 20307249
Ataxia Telangiectasia	Associate	11709514
Atherosclerosis	Associate	28821884
Autoimmune Diseases	Associate	24138069, 29328375, 30936868
Blister	Associate	15320912
Brain Ischemia	Associate	24288444
Breast Neoplasms	Stimulate	37910571
Carcinogenesis	Associate	32606144, 37929521
Carcinoma Hepatocellular	Associate	34897107
Carcinoma Non Small Cell Lung	Associate	25597281
Carcinoma Renal Cell	Associate	26823871
Carcinoma Renal Cell	Stimulate	40612864
Cardiovascular Diseases	Associate	34927450
Cerebral Infarction	Associate	24288444
Cholangiocarcinoma	Associate	30168369
Colitis Ulcerative	Stimulate	11171821, 37228614
Colorectal Neoplasms	Associate	22187702, 26764183, 33779485, 38291041
Corneal dystrophy Avellino type	Associate	30829721
Coronary Artery Disease	Associate	23881440, 32223966
Coronary Disease	Associate	23881440
Crohn Disease	Associate	11709514
Death	Associate	28807247
Diabetes Gestational	Associate	28580570
Diabetes Mellitus	Associate	26823871
Diabetes Mellitus Type 2	Associate	31375554
Drug Hypersensitivity	Associate	17303923
Drug Related Side Effects and Adverse Reactions	Associate	30194076
Emphysema	Associate	24138069
Endometriosis	Associate	29328375, 37170270
Fibrosis	Associate	16447204
Fibrous Dysplasia Polyostotic	Associate	19220835
Glaucoma Open Angle	Associate	26820987
Glioma	Associate	37929521
Glomerulonephritis IGA	Associate	31067541
Goiter Multinodular 2	Associate	25940130
Graft vs Host Disease	Associate	39201599
Graves Disease	Associate	18832736, 25940130
Graves Disease	Stimulate	22506015
Hand Foot and Mouth Disease	Inhibit	24367714
Hashimoto Disease	Associate	25940130, 35720300
HIV Infections	Associate	12390317, 17511776, 19251297, 9566794
HTLV I Infections	Associate	10447738
Hypertension	Associate	26823871
Hypertriglyceridemia	Associate	24288444
Infarction	Associate	33122738
Inflammation	Associate	10504456, 10809960, 11171821, 17982032, 20307249, 21654189, 24101193, 24551286, 25710036, 25904748, 25954818, 27703190, 29328375, 29884309, 30829721 View all (7 more)
Inflammatory Bowel Diseases	Stimulate	11171821, 37228614
Inflammatory Bowel Diseases	Associate	26764183
Intervertebral Disc Degeneration	Associate	24551286
Intervertebral disc disease	Associate	24551286, 24971599
Ischemic Stroke	Associate	35673992
Keratoconus	Stimulate	27157003
Kidney Diseases	Associate	34783463
Kidney Failure Chronic	Stimulate	24471420
Leukemia Biphenotypic Acute	Associate	37845689
Leukemia Lymphocytic Chronic B Cell	Associate	33931471
Lichen Planus	Associate	37317627
Lichen Planus Oral	Associate	37317627
Liver Cirrhosis Biliary	Associate	28425483
Lung Diseases	Associate	20307249, 24138069
Lung Neoplasms	Associate	25597281, 30671474, 32354900
Lupus Erythematosus Cutaneous	Stimulate	33931094
Lupus Erythematosus Systemic	Associate	19440200
Lupus Erythematosus Systemic	Stimulate	36104119
Lupus Nephritis	Associate	34783463, 36104119
Lymphoma Non Hodgkin	Associate	19066394
Lymphoma T Cell Cutaneous	Associate	22080865
Measles	Associate	17538120
Meningism	Associate	12605702
Meningitis Aseptic	Associate	12605702
Meningitis Bacterial	Stimulate	12605702
Mouth Neoplasms	Associate	32606144
Multiple Myeloma	Associate	28512269
Mycosis Fungoides	Associate	10504456
Nasopharyngeal Carcinoma	Associate	24101193
Neoplasms	Inhibit	20093405
Neoplasms	Associate	24101193, 26764183, 28512269, 32862475, 34897107, 34968167, 35568781, 38006433, 38291041
Neoplasms	Stimulate	40612864
Nephritis	Associate	34783463
Nerve Degeneration	Associate	24551286
Neuroendocrine Tumors	Associate	33968055
Neurologic Manifestations	Stimulate	17551575
Non alcoholic Fatty Liver Disease	Inhibit	39583964
Obesity	Associate	25710036
Osteoarthritis	Associate	37259724
Osteoarthritis Knee	Associate	25954818
Osteosarcoma	Associate	27703190
Ovarian Diseases	Associate	35497879
Overweight	Associate	25710036
Pancreatitis	Associate	28574850
Pemphigoid Bullous	Associate	15320912
Periodontitis	Associate	16178875, 32915917
Prostatic Neoplasms	Associate	22923025, 24061634
Prostatitis	Stimulate	37170270
Pulmonary Disease Chronic Obstructive	Associate	24138069
Pulmonary Disease Chronic Obstructive	Stimulate	25125975
Pulmonary edema of mountaineers	Associate	34483727
Purpura Thrombocytopenic Idiopathic	Stimulate	23869085
Purpura Thrombocytopenic Idiopathic	Associate	30936868
Respiratory Tract Infections	Inhibit	30193587
Retinal Detachment	Stimulate	32542038
Retinal Detachment	Associate	33371882
Retinal Vein Occlusion	Associate	31814701
Retinitis Pigmentosa	Inhibit	39472110
Rhinitis Allergic	Associate	20307249
Sarcopenia	Associate	35215488
Skin Diseases	Associate	10504456
Small Cell Lung Carcinoma	Associate	30671474
Stomach Neoplasms	Associate	24175812, 26346169, 34968167, 35215488, 38148080
Stomach Neoplasms	Stimulate	39173282
Stroke	Associate	35673992
Takayasu Arteritis	Associate	35172901
Thrombosis	Associate	28574850
Thyroiditis Autoimmune	Associate	27245471
Tuberculosis Meningeal	Associate	24971599
Urinary Bladder Neoplasms	Associate	32862475
Uterine Cervical Neoplasms	Associate	24465869
Uterine Cervical Neoplasms	Stimulate	24465869
Whipple Disease	Stimulate	17551575, 21364641

IL16 (interleukin 16)