Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3601
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 15 receptor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL15RA
Synonyms (NCBI Gene) Gene synonyms aliases
CD215
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10p15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT735808 hsa-miR-370-3p Luciferase reporter assay 31513636
MIRT1063731 hsa-miR-1225-5p CLIP-seq
MIRT1063732 hsa-miR-150 CLIP-seq
MIRT1063733 hsa-miR-2054 CLIP-seq
MIRT1063734 hsa-miR-4312 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0001779 Process Natural killer cell differentiation IEA
GO:0004896 Function Cytokine receptor activity TAS 7641685
GO:0005515 Function Protein binding IPI 16284400, 23104097
GO:0005576 Component Extracellular region IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
601070 5978 ENSG00000134470
Protein
UniProt ID Q13261
Protein name Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
Protein function High-affinity receptor for interleukin-15 (PubMed:8530383). Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells (By similarity). In neutrophils, binds and activates kinase SYK
PDB 2ERS , 2Z3Q , 2Z3R , 4GS7
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in neutrophils (at protein level) (PubMed:15123770). Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus (PubMed:12114302). Higher levels of soluble sIL-15RA form in c
Sequence
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTWGTSSRDEDLENCSHHL
Sequence length 267
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Intestinal immune network for IgA production
Human T-cell leukemia virus 1 infection
Pathways in cancer
  Interleukin-15 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dermatitis Atopic dermatitis N/A N/A GWAS
Eczema Eczema N/A N/A GWAS
Glioblastoma Glioblastoma N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Ablepharon macrostomia syndrome Associate 39457093
Arthritis Rheumatoid Associate 25879761, 30407753
Breast Neoplasms Associate 23996684
Calcinosis Cutis Associate 37334356
Cartilage Diseases Associate 32793194
Celiac Disease Associate 27794069
Celiac Disease Stimulate 31622625
Chagas Cardiomyopathy Associate 17635814
Colitis Ulcerative Stimulate 23039249
Colorectal Neoplasms Associate 27794069