Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3601
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 15 receptor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL15RA
Synonyms (NCBI Gene) Gene synonyms aliases	CD215
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10p15.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cytokine receptor that specifically binds interleukin 15 (IL15) with high affinity. The receptors of IL15 and IL2 share two subunits, IL2R beta and IL2R gamma. This forms the basis of many overlapping biological activities of IL15 and

Show/Hide all(102)

miRTarBase ID	miRNA	Experiments	Reference
MIRT735808	hsa-miR-370-3p	Luciferase reporter assay	31513636
MIRT1063731	hsa-miR-1225-5p	CLIP-seq
MIRT1063732	hsa-miR-150	CLIP-seq
MIRT1063733	hsa-miR-2054	CLIP-seq
MIRT1063734	hsa-miR-4312	CLIP-seq
MIRT1063735	hsa-miR-4434	CLIP-seq
MIRT1063736	hsa-miR-4516	CLIP-seq
MIRT1063737	hsa-miR-4713-5p	CLIP-seq
MIRT1063738	hsa-miR-4768-3p	CLIP-seq
MIRT1063739	hsa-miR-4768-5p	CLIP-seq
MIRT1063740	hsa-miR-532-3p	CLIP-seq
MIRT1063741	hsa-miR-662	CLIP-seq
MIRT1063742	hsa-miR-665	CLIP-seq
MIRT1063743	hsa-miR-668	CLIP-seq
MIRT1063744	hsa-miR-1224-3p	CLIP-seq
MIRT1063745	hsa-miR-1260	CLIP-seq
MIRT1063746	hsa-miR-1260b	CLIP-seq
MIRT1063747	hsa-miR-1280	CLIP-seq
MIRT1063732	hsa-miR-150	CLIP-seq
MIRT1063748	hsa-miR-1915	CLIP-seq
MIRT1063737	hsa-miR-4713-5p	CLIP-seq
MIRT1063749	hsa-miR-4726-3p	CLIP-seq
MIRT1063740	hsa-miR-532-3p	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT2015102	hsa-miR-205	CLIP-seq
MIRT2015103	hsa-miR-296-5p	CLIP-seq
MIRT2015104	hsa-miR-320e	CLIP-seq
MIRT2015105	hsa-miR-4646-5p	CLIP-seq
MIRT2015106	hsa-miR-4747-5p	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT2015103	hsa-miR-296-5p	CLIP-seq
MIRT2015104	hsa-miR-320e	CLIP-seq
MIRT2015105	hsa-miR-4646-5p	CLIP-seq
MIRT2015106	hsa-miR-4747-5p	CLIP-seq
MIRT2550876	hsa-miR-1200	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT2550877	hsa-miR-185	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT2015102	hsa-miR-205	CLIP-seq
MIRT2550878	hsa-miR-219-1-3p	CLIP-seq
MIRT2015103	hsa-miR-296-5p	CLIP-seq
MIRT2550879	hsa-miR-3140-5p	CLIP-seq
MIRT2015104	hsa-miR-320e	CLIP-seq
MIRT2550880	hsa-miR-4306	CLIP-seq
MIRT2550881	hsa-miR-4644	CLIP-seq
MIRT2015105	hsa-miR-4646-5p	CLIP-seq
MIRT2550882	hsa-miR-4659a-3p	CLIP-seq
MIRT2550883	hsa-miR-4659b-3p	CLIP-seq
MIRT2550884	hsa-miR-4682	CLIP-seq
MIRT2015106	hsa-miR-4747-5p	CLIP-seq
MIRT2550885	hsa-miR-4778-3p	CLIP-seq
MIRT2550886	hsa-miR-500a	CLIP-seq
MIRT2550887	hsa-miR-571	CLIP-seq
MIRT2550888	hsa-miR-639	CLIP-seq
MIRT2550876	hsa-miR-1200	CLIP-seq
MIRT1063744	hsa-miR-1224-3p	CLIP-seq
MIRT1063745	hsa-miR-1260	CLIP-seq
MIRT1063746	hsa-miR-1260b	CLIP-seq
MIRT1063747	hsa-miR-1280	CLIP-seq
MIRT1550101	hsa-miR-133a	CLIP-seq
MIRT1550102	hsa-miR-133b	CLIP-seq
MIRT1550103	hsa-miR-1343	CLIP-seq
MIRT1063732	hsa-miR-150	CLIP-seq
MIRT2550877	hsa-miR-185	CLIP-seq
MIRT1063748	hsa-miR-1915	CLIP-seq
MIRT1550104	hsa-miR-1976	CLIP-seq
MIRT2015102	hsa-miR-205	CLIP-seq
MIRT2550878	hsa-miR-219-1-3p	CLIP-seq
MIRT2682755	hsa-miR-24	CLIP-seq
MIRT2015103	hsa-miR-296-5p	CLIP-seq
MIRT2550879	hsa-miR-3140-5p	CLIP-seq
MIRT2015104	hsa-miR-320e	CLIP-seq
MIRT2682756	hsa-miR-378g	CLIP-seq
MIRT2550880	hsa-miR-4306	CLIP-seq
MIRT2682757	hsa-miR-4310	CLIP-seq
MIRT2682758	hsa-miR-4437	CLIP-seq
MIRT2550881	hsa-miR-4644	CLIP-seq
MIRT2015105	hsa-miR-4646-5p	CLIP-seq
MIRT2550882	hsa-miR-4659a-3p	CLIP-seq
MIRT2550883	hsa-miR-4659b-3p	CLIP-seq
MIRT2682759	hsa-miR-4674	CLIP-seq
MIRT2550884	hsa-miR-4682	CLIP-seq
MIRT1063737	hsa-miR-4713-5p	CLIP-seq
MIRT1063749	hsa-miR-4726-3p	CLIP-seq
MIRT2015106	hsa-miR-4747-5p	CLIP-seq
MIRT2550885	hsa-miR-4778-3p	CLIP-seq
MIRT2550886	hsa-miR-500a	CLIP-seq
MIRT1063740	hsa-miR-532-3p	CLIP-seq
MIRT2550887	hsa-miR-571	CLIP-seq
MIRT2550888	hsa-miR-639	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0004896	Function	Cytokine receptor activity	TAS	7641685
GO:0005515	Function	Protein binding	IPI	16284400, 23104097
GO:0005615	Component	Extracellular space	IEA
GO:0005768	Component	Endosome	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0009986	Component	Cell surface	IDA	15123770
GO:0016021	Component	Integral component of membrane	IEA
GO:0019901	Function	Protein kinase binding	IPI	15123770
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IBA	21873635
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IMP	15123770
GO:0035723	Process	Interleukin-15-mediated signaling pathway	TAS
GO:0042010	Function	Interleukin-15 receptor activity	IBA	21873635
GO:0042010	Function	Interleukin-15 receptor activity	IDA	15123770
GO:0050766	Process	Positive regulation of phagocytosis	IMP	15123770

MIM	HGNC	e!Ensembl
601070	5978	ENSG00000134470

Protein

UniProt ID

Q13261

Protein name

Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]

Protein function

High-affinity receptor for interleukin-15 (PubMed:8530383). Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells (By similarity). In neutrophils, binds and activates kinase SYK

PDB

2ERS , 2Z3Q , 2Z3R , 4GS7

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in neutrophils (at protein level) (PubMed:15123770). Expressed in fetal brain with higher expression in the hippocampus and cerebellum than in cortex and thalamus (PubMed:12114302). Higher levels of soluble sIL-15RA form in c

Sequence

MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTWGTSSRDEDLENCSHHL

Sequence length

267

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Intestinal immune network for IgA production Human T-cell leukemia virus 1 infection Pathways in cancer		Interleukin-15 signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959

Show/Hide Unknown Diseases (3)

Disease term	Disease name	Evidence	Source
Unknown
Dermatitis	Dermatitis		GWAS
Eczema	Eczema		GWAS
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587	GWAS, CBGDA

Show/Hide Text Mining Associations (43)

Disease Name	Relationship Type	References
Associations from Text Mining
Ablepharon macrostomia syndrome	Associate	39457093
Arthritis Rheumatoid	Associate	25879761, 30407753
Breast Neoplasms	Associate	23996684
Calcinosis Cutis	Associate	37334356
Cartilage Diseases	Associate	32793194
Celiac Disease	Associate	27794069
Celiac Disease	Stimulate	31622625
Chagas Cardiomyopathy	Associate	17635814
Colitis Ulcerative	Stimulate	23039249
Colorectal Neoplasms	Associate	27794069
Coronary Artery Disease	Associate	24603895
Crohn Disease	Associate	22128034
Crohn Disease	Stimulate	23039249
Dermatitis Atopic	Associate	28821884
Disease	Associate	16105889
Disease	Stimulate	18821940
DNA Repair Deficiency Disorders	Stimulate	31991061
Epstein Barr Virus Infections	Inhibit	19264676
Hantavirus Infections	Associate	25412359
Heart Diseases	Associate	17635814
Infections	Stimulate	11160322
Infectious Mononucleosis	Associate	16543467
Inflammation	Associate	27794069, 40133606
Inflammatory Bowel Diseases	Associate	23039249, 27794069
Leukemia	Associate	15651075
Leukemia Large Granular Lymphocytic	Stimulate	22049515
Leukemia Lymphoma Adult T Cell	Stimulate	12023365
Mastitis	Associate	35331909
Melanoma	Associate	37334356, 37923822
Metabolic Syndrome	Associate	18514540
Neoplasms	Associate	23996684, 33763293, 37923822
Neuralgia	Associate	32793194
Neuroblastoma	Associate	32599975
Neurodegenerative Diseases	Associate	32793194
Obesity	Associate	19309557, 33487124
Ossification of the posterior longitudinal ligament of the spine	Associate	25387549
Osteoarthritis	Associate	32793194
Ovarian Neoplasms	Associate	31991061
Overweight	Associate	19309557
Paraparesis Tropical Spastic	Associate	11160322
Peripheral Arterial Disease	Associate	39221259
Pulmonary Embolism	Associate	33529319
Stomach Neoplasms	Associate	24696261

IL15RA (interleukin 15 receptor subunit alpha)