Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID	3600
Gene name	Interleukin 15
Gene symbol	IL15
Synonyms (NCBI Gene)	IL-15
Chromosome	4
Chromosome location	4q31.21
Summary	The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024918	hsa-miR-215-5p	Microarray	19074876
MIRT026532	hsa-miR-192-5p	Microarray	19074876
MIRT724031	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT724030	hsa-miR-5688	HITS-CLIP	19536157
MIRT724029	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT724028	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT724027	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT724026	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT724025	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT724024	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT736114	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCR	33066457
MIRT736423	hsa-miR-491-3p	qRT-PCRFlow cytometry	33679688
MIRT724031	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT724030	hsa-miR-5688	HITS-CLIP	19536157
MIRT724029	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT724028	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT724027	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT724026	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT724025	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT724024	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT1063727	hsa-miR-199a-3p	CLIP-seq
MIRT1063728	hsa-miR-199b-3p	CLIP-seq
MIRT1063729	hsa-miR-3129-5p	CLIP-seq
MIRT1063730	hsa-miR-936	CLIP-seq
MIRT2247390	hsa-miR-1264	CLIP-seq
MIRT2247391	hsa-miR-4251	CLIP-seq
MIRT2247392	hsa-miR-4329	CLIP-seq
MIRT2389340	hsa-miR-140-5p	CLIP-seq
MIRT1063727	hsa-miR-199a-3p	CLIP-seq
MIRT1063728	hsa-miR-199b-3p	CLIP-seq
MIRT1063729	hsa-miR-3129-5p	CLIP-seq
MIRT2389341	hsa-miR-4676-5p	CLIP-seq
MIRT2389342	hsa-miR-4697-3p	CLIP-seq
MIRT2389343	hsa-miR-4712-3p	CLIP-seq
MIRT2389344	hsa-miR-575	CLIP-seq
MIRT2550848	hsa-miR-105	CLIP-seq
MIRT2550849	hsa-miR-130a	CLIP-seq
MIRT2550850	hsa-miR-130b	CLIP-seq
MIRT2550851	hsa-miR-148a	CLIP-seq
MIRT2550852	hsa-miR-148b	CLIP-seq
MIRT2550853	hsa-miR-152	CLIP-seq
MIRT2550854	hsa-miR-301a	CLIP-seq
MIRT2550855	hsa-miR-301b	CLIP-seq
MIRT2550856	hsa-miR-3074-3p	CLIP-seq
MIRT2550857	hsa-miR-3620	CLIP-seq
MIRT2550858	hsa-miR-3666	CLIP-seq
MIRT2550859	hsa-miR-4295	CLIP-seq
MIRT2550860	hsa-miR-4502	CLIP-seq
MIRT2550861	hsa-miR-450b-5p	CLIP-seq
MIRT2550862	hsa-miR-454	CLIP-seq
MIRT2550863	hsa-miR-507	CLIP-seq
MIRT2550864	hsa-miR-548ac	CLIP-seq
MIRT2550865	hsa-miR-548ad	CLIP-seq
MIRT2550866	hsa-miR-548ae	CLIP-seq
MIRT2550867	hsa-miR-548aj	CLIP-seq
MIRT2550868	hsa-miR-548am	CLIP-seq
MIRT2550869	hsa-miR-548d-3p	CLIP-seq
MIRT2550870	hsa-miR-548x	CLIP-seq
MIRT2550871	hsa-miR-548z	CLIP-seq
MIRT2550872	hsa-miR-556-5p	CLIP-seq
MIRT2550873	hsa-miR-557	CLIP-seq
MIRT2550874	hsa-miR-610	CLIP-seq
MIRT2550875	hsa-miR-891b	CLIP-seq
MIRT2550848	hsa-miR-105	CLIP-seq
MIRT2682752	hsa-miR-2052	CLIP-seq
MIRT2550856	hsa-miR-3074-3p	CLIP-seq
MIRT2550857	hsa-miR-3620	CLIP-seq
MIRT2682753	hsa-miR-3659	CLIP-seq
MIRT2550860	hsa-miR-4502	CLIP-seq
MIRT2550861	hsa-miR-450b-5p	CLIP-seq
MIRT2550863	hsa-miR-507	CLIP-seq
MIRT2550864	hsa-miR-548ac	CLIP-seq
MIRT2550866	hsa-miR-548ae	CLIP-seq
MIRT2550867	hsa-miR-548aj	CLIP-seq
MIRT2550868	hsa-miR-548am	CLIP-seq
MIRT2550869	hsa-miR-548d-3p	CLIP-seq
MIRT2550870	hsa-miR-548x	CLIP-seq
MIRT2550871	hsa-miR-548z	CLIP-seq
MIRT2550872	hsa-miR-556-5p	CLIP-seq
MIRT2550873	hsa-miR-557	CLIP-seq
MIRT2550874	hsa-miR-610	CLIP-seq
MIRT2682754	hsa-miR-654-3p	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
HOXA10	Activation	20478621
MYB	Activation	11675351

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001787	Process	Natural killer cell proliferation	IEA
GO:0001819	Process	Positive regulation of cytokine production	IBA
GO:0001866	Process	NK T cell proliferation	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	9097905
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	16284400, 23104097, 25416956
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	9097905
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	10851076
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10851076
GO:0005768	Component	Endosome	TAS	10851076
GO:0005794	Component	Golgi apparatus	TAS	10851076
GO:0005829	Component	Cytosol	IDA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	8178155
GO:0007165	Process	Signal transduction	TAS	8178155
GO:0007260	Process	Tyrosine phosphorylation of STAT protein	IDA	12244150
GO:0007267	Process	Cell-cell signaling	TAS	7759105
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	10851076
GO:0016607	Component	Nuclear speck	IDA
GO:0030225	Process	Macrophage differentiation	IDA	24942581
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IEA
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	9097905, 15123770, 24942581
GO:0042102	Process	Positive regulation of T cell proliferation	IBA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042119	Process	Neutrophil activation	IBA
GO:0042119	Process	Neutrophil activation	IDA	15123770
GO:0045062	Process	Extrathymic T cell selection	IEA
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0048469	Process	Cell maturation	IEA
GO:0048535	Process	Lymph node development	IEA
GO:0050691	Process	Regulation of defense response to virus by host	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050731	Process	Positive regulation of peptidyl-tyrosine phosphorylation	IDA	15123770
GO:0050766	Process	Positive regulation of phagocytosis	IDA	15123770
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050778	Process	Positive regulation of immune response	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	27684068

MIM	HGNC	e!Ensembl
600554	5977	ENSG00000164136

P40933

Protein name

Interleukin-15 (IL-15)

Protein function

Cytokine that plays a major role in the development of inflammatory and protective immune responses to microbial invaders and parasites by modulating immune cells of both the innate and adaptive immune systems (PubMed:15123770). Stimulates the p

PDB

2XQB , 2Z3Q , 2Z3R , 4GS7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02372	IL15	33 → 160	Interleukin 15	Domain

Tissue specificity

TISSUE SPECIFICITY: Most abundant in placenta and skeletal muscle. It is also detected in the heart, lung, liver and kidney. IL15-S21AA is preferentially expressed in tissues such as testis and thymus.

Sequence

MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS

Sequence length

162

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway TNF signaling pathway Intestinal immune network for IgA production Human T-cell leukemia virus 1 infection Pathways in cancer Rheumatoid arthritis		Interleukin-15 signaling

IL15 (interleukin 15)