RFLNB (refilin B)

Gene

• Entrez ID: 359845
• Gene name: Refilin B
• Gene symbol: RFLNB
• Synonyms (NCBI Gene): CFM1, FAM101B
• Chromosome: 17
• Chromosome location: 17p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT710719	hsa-miR-888-5p	HITS-CLIP	19536157
MIRT710718	hsa-miR-4691-3p	HITS-CLIP	19536157
MIRT710717	hsa-miR-3157-5p	HITS-CLIP	19536157

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0031005	Function	Filamin binding	IBA
GO:0031005	Function	Filamin binding	IDA	21709252
GO:0031005	Function	Filamin binding	IEA
GO:0032432	Component	Actin filament bundle	IBA
GO:0032432	Component	Actin filament bundle	IEA
GO:0048705	Process	Skeletal system morphogenesis	IBA
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0061181	Process	Regulation of chondrocyte development	IEA
GO:0061182	Process	Negative regulation of chondrocyte development	IBA
GO:0061182	Process	Negative regulation of chondrocyte development	IEA
GO:0061572	Process	Actin filament bundle organization	IBA
GO:0061572	Process	Actin filament bundle organization	IEA
GO:0061572	Process	Actin filament bundle organization	IEA
GO:1900158	Process	Negative regulation of bone mineralization involved in bone maturation	IBA
GO:1900158	Process	Negative regulation of bone mineralization involved in bone maturation	IEA

Other IDs

• MIM: 615928
• HGNC: 28705
• e!Ensembl: ENSG00000183688

Protein

• UniProt ID: Q8N5W9
• Protein name: Refilin-B (Regulator of filamin protein B) (RefilinB)
• Protein function: Involved in the regulation of the perinuclear actin network and nuclear shape through interaction with filamins. Plays an essential role in the formation of cartilaginous skeletal elements.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15068	FAM101	1 → 202	FAM101 family	Family

• Sequence:

  MVGRLSLQDVPELVDAKKKGDGVLDSPDSGLPPSPSPSHWGLAAGGGGGERAAAPGTLEP
  DAAAATPAAPSPASLPLAPGCALRLCPLSFGEGVEFDPLPPKEVRYTSLVKYDSERHFID
  DVQLPLGLAVASCSQTVTCVPNGTWRNYKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTT
  TLDYNCRKTLRRFLSSVELEAAELPGSDDLSDEC

• Sequence length: 214