Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3597
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 13 receptor subunit alpha 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL13RA1
Synonyms (NCBI Gene) Gene synonyms aliases
CD213A1, CT19, IL-13Ra, NR4
Chromosome Chromosome number
X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
Xq24
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 rece
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT006687 hsa-miR-155-5p Luciferase reporter assay 21097505
MIRT006687 hsa-miR-155-5p Luciferase reporter assay 21097505
MIRT006687 hsa-miR-155-5p Luciferase reporter assay 21097505
MIRT006687 hsa-miR-155-5p Luciferase reporter assay 21097505
MIRT438056 hsa-miR-143-3p qRT-PCR, Western blot 23965966
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002639 Process Positive regulation of immunoglobulin production IBA
GO:0004896 Function Cytokine receptor activity IBA
GO:0004896 Function Cytokine receptor activity IEA
GO:0005515 Function Protein binding IPI 12935900, 18243101, 20223216, 33961781
GO:0005886 Component Plasma membrane TAS 9083087
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
300119 5974 ENSG00000131724
Protein
UniProt ID P78552
Protein name Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
Protein function Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but canno
PDB 3BPN , 3BPO , 4HWB , 5E4E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18001 Il13Ra_Ig 31 125 Interleukin-13 receptor subunit alpha Ig-like domain Domain
PF09240 IL6Ra-bind 131 225 Interleukin-6 receptor alpha chain, binding Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
Sequence
MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASS
NCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISP
PEGDP
ESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREG
QYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSR
VKPDPPHIKNLSFHN
DDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVP
GVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAI
IVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIE
NLKKASQ
Sequence length 427
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Pathways in cancer
  Interleukin-4 and Interleukin-13 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Aortic Aneurysm Aortic aneurysm N/A N/A GWAS
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 33591997
Astrocytoma Associate 10946814
Breast Neoplasms Associate 33597614, 34600547
Cholangitis Sclerosing Associate 35194091
Colitis Ulcerative Stimulate 20014020
Colorectal Neoplasms Stimulate 20014020
Colorectal Neoplasms Associate 27533463
Crohn Disease Stimulate 20014020
Crohn Disease Associate 23300643
Cystic Fibrosis Associate 30177416