Gene Gene information from NCBI Gene database.
Entrez ID 3597
Gene name Interleukin 13 receptor subunit alpha 1
Gene symbol IL13RA1
Synonyms (NCBI Gene)
CD213A1CT19IL-13RaNR4
Chromosome X
Chromosome location Xq24
Summary The protein encoded by this gene is a subunit of the interleukin 13 receptor. This subunit forms a receptor complex with IL4 receptor alpha, a subunit shared by IL13 and IL4 receptors. This subunit serves as a primary IL13-binding subunit of the IL13 rece
miRNA miRNA information provided by mirtarbase database.
370
miRTarBase ID miRNA Experiments Reference
MIRT006687 hsa-miR-155-5p Luciferase reporter assay 21097505
MIRT006687 hsa-miR-155-5p Luciferase reporter assay 21097505
MIRT006687 hsa-miR-155-5p Luciferase reporter assay 21097505
MIRT006687 hsa-miR-155-5p Luciferase reporter assay 21097505
MIRT438056 hsa-miR-143-3p qRT-PCRWestern blot 23965966
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
13
GO ID Ontology Definition Evidence Reference
GO:0002639 Process Positive regulation of immunoglobulin production IBA
GO:0004896 Function Cytokine receptor activity IBA
GO:0004896 Function Cytokine receptor activity IEA
GO:0005515 Function Protein binding IPI 12935900, 18243101, 20223216, 33961781
GO:0005886 Component Plasma membrane TAS 9083087
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
300119 5974 ENSG00000131724
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P78552
Protein name Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
Protein function Binds with low affinity to interleukin-13 (IL13). Together with IL4RA can form a functional receptor for IL13. Also serves as an alternate accessory protein to the common cytokine receptor gamma chain for interleukin-4 (IL4) signaling, but canno
PDB 3BPN , 3BPO , 4HWB , 5E4E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18001 Il13Ra_Ig 31 125 Interleukin-13 receptor subunit alpha Ig-like domain Domain
PF09240 IL6Ra-bind 131 225 Interleukin-6 receptor alpha chain, binding Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highest levels in heart, liver, skeletal muscle and ovary; lowest levels in brain, lung and kidney. Also found in B-cells, T-cells and endothelial cells.
Sequence
MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASS
NCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISP
PEGDP
ESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREG
QYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSR
VKPDPPHIKNLSFHN
DDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVP
GVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAI
IVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIE
NLKKASQ
Sequence length 427
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Pathways in cancer
  Interleukin-4 and Interleukin-13 signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Thyroid cancer, nonmedullary, 1 Uncertain significance rs148722500 RCV005930831
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adrenocortical Carcinoma Associate 33591997
Astrocytoma Associate 10946814
Breast Neoplasms Associate 33597614, 34600547
Cholangitis Sclerosing Associate 35194091
Colitis Ulcerative Stimulate 20014020
Colorectal Neoplasms Stimulate 20014020
Colorectal Neoplasms Associate 27533463
Crohn Disease Stimulate 20014020
Crohn Disease Associate 23300643
Cystic Fibrosis Associate 30177416