Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3594
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 12 receptor subunit beta 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL12RB1
Synonyms (NCBI Gene) Gene synonyms aliases	CD212, IL-12R-BETA1, IL12RB, IMD30
Disease Acronyms (UniProt) Disease acronyms from UniProt database	IMD30
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.11
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a type I transmembrane protein that belongs to the hemopoietin receptor superfamily. This protein binds to interleukine 12 (IL12) with a low affinity, and is thought to be a part of IL12 receptor complex. This protein f

Show/Hide all(16)

SNP ID	Visualize variation	Clinical significance	Consequence
rs11575925	G>C	Conflicting-interpretations-of-pathogenicity	Missense variant, upstream transcript variant, coding sequence variant, genic upstream transcript variant
rs121434492	G>A	Pathogenic	Coding sequence variant, genic upstream transcript variant, stop gained
rs121434493	G>A	Pathogenic	Coding sequence variant, genic downstream transcript variant, stop gained
rs121434494	G>A	Pathogenic	Coding sequence variant, missense variant
rs121434495	A>G	Pathogenic	5 prime UTR variant, coding sequence variant, missense variant
rs147766868	G>A,C,T	Uncertain-significance, pathogenic	Missense variant, stop gained, coding sequence variant
rs554063682	A>C	Pathogenic	Splice donor variant, genic downstream transcript variant
rs564884307	C>A,T	Uncertain-significance, pathogenic	5 prime UTR variant, stop gained, missense variant, coding sequence variant
rs587776680	C>G,T	Pathogenic	Splice donor variant
rs756272570	C>G,T	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs1057524791	A>T	Likely-pathogenic	Coding sequence variant, 5 prime UTR variant, missense variant
rs1202592147	G>A,C	Pathogenic	Synonymous variant, genic upstream transcript variant, upstream transcript variant, stop gained, coding sequence variant
rs1476855887	C>-	Pathogenic	Coding sequence variant, genic downstream transcript variant, frameshift variant
rs1555782866	T>A	Pathogenic	Coding sequence variant, stop gained
rs1568515222	CCCG>-	Pathogenic	Genic upstream transcript variant, coding sequence variant, frameshift variant, upstream transcript variant
rs1599555124	T>-	Pathogenic	Genic upstream transcript variant, coding sequence variant, frameshift variant, upstream transcript variant

Show/Hide all(295)

miRTarBase ID	miRNA	Experiments	Reference
MIRT756167	hsa-miR-146a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Immunohistochemistry (IHC), Flow cytometry	35819446
MIRT1063613	hsa-miR-1225-3p	CLIP-seq
MIRT1063614	hsa-miR-1228	CLIP-seq
MIRT1063615	hsa-miR-1233	CLIP-seq
MIRT1063616	hsa-miR-1273f	CLIP-seq
MIRT1063617	hsa-miR-1277	CLIP-seq
MIRT1063618	hsa-miR-1285	CLIP-seq
MIRT1063619	hsa-miR-1293	CLIP-seq
MIRT1063620	hsa-miR-2114	CLIP-seq
MIRT1063621	hsa-miR-24	CLIP-seq
MIRT1063622	hsa-miR-3122	CLIP-seq
MIRT1063623	hsa-miR-3137	CLIP-seq
MIRT1063624	hsa-miR-3165	CLIP-seq
MIRT1063625	hsa-miR-3187-5p	CLIP-seq
MIRT1063626	hsa-miR-3190	CLIP-seq
MIRT1063627	hsa-miR-3192	CLIP-seq
MIRT1063628	hsa-miR-3202	CLIP-seq
MIRT1063629	hsa-miR-323-5p	CLIP-seq
MIRT1063630	hsa-miR-342-3p	CLIP-seq
MIRT1063631	hsa-miR-3614-5p	CLIP-seq
MIRT1063632	hsa-miR-3616-3p	CLIP-seq
MIRT1063633	hsa-miR-3622b-5p	CLIP-seq
MIRT1063634	hsa-miR-3665	CLIP-seq
MIRT1063635	hsa-miR-3672	CLIP-seq
MIRT1063636	hsa-miR-3689a-3p	CLIP-seq
MIRT1063637	hsa-miR-3689c	CLIP-seq
MIRT1063638	hsa-miR-3714	CLIP-seq
MIRT1063639	hsa-miR-3913-5p	CLIP-seq
MIRT1063640	hsa-miR-3922-5p	CLIP-seq
MIRT1063641	hsa-miR-3926	CLIP-seq
MIRT1063642	hsa-miR-3929	CLIP-seq
MIRT1063643	hsa-miR-3934	CLIP-seq
MIRT1063644	hsa-miR-3945	CLIP-seq
MIRT1063645	hsa-miR-4253	CLIP-seq
MIRT1063646	hsa-miR-4284	CLIP-seq
MIRT1063647	hsa-miR-4314	CLIP-seq
MIRT1063648	hsa-miR-4419b	CLIP-seq
MIRT1063649	hsa-miR-4433	CLIP-seq
MIRT1063650	hsa-miR-4436b-3p	CLIP-seq
MIRT1063651	hsa-miR-4459	CLIP-seq
MIRT1063652	hsa-miR-4478	CLIP-seq
MIRT1063653	hsa-miR-4483	CLIP-seq
MIRT1063654	hsa-miR-4505	CLIP-seq
MIRT1063655	hsa-miR-4533	CLIP-seq
MIRT1063656	hsa-miR-4646-5p	CLIP-seq
MIRT1063657	hsa-miR-4721	CLIP-seq
MIRT1063658	hsa-miR-4722-5p	CLIP-seq
MIRT1063659	hsa-miR-4728-5p	CLIP-seq
MIRT1063660	hsa-miR-4733-5p	CLIP-seq
MIRT1063661	hsa-miR-4736	CLIP-seq
MIRT1063662	hsa-miR-4738-3p	CLIP-seq
MIRT1063663	hsa-miR-4768-3p	CLIP-seq
MIRT1063664	hsa-miR-4786-5p	CLIP-seq
MIRT1063665	hsa-miR-548s	CLIP-seq
MIRT1063666	hsa-miR-612	CLIP-seq
MIRT1063667	hsa-miR-627	CLIP-seq
MIRT1063668	hsa-miR-654-3p	CLIP-seq
MIRT1063669	hsa-miR-661	CLIP-seq
MIRT1063670	hsa-miR-665	CLIP-seq
MIRT1063671	hsa-miR-769-5p	CLIP-seq
MIRT1063672	hsa-miR-876-3p	CLIP-seq
MIRT1063673	hsa-miR-924	CLIP-seq
MIRT1063674	hsa-miR-940	CLIP-seq
MIRT1063649	hsa-miR-4433	CLIP-seq
MIRT1063651	hsa-miR-4459	CLIP-seq
MIRT1063663	hsa-miR-4768-3p	CLIP-seq
MIRT1063613	hsa-miR-1225-3p	CLIP-seq
MIRT1063614	hsa-miR-1228	CLIP-seq
MIRT1063615	hsa-miR-1233	CLIP-seq
MIRT1063618	hsa-miR-1285	CLIP-seq
MIRT1063619	hsa-miR-1293	CLIP-seq
MIRT1063620	hsa-miR-2114	CLIP-seq
MIRT1063622	hsa-miR-3122	CLIP-seq
MIRT1063623	hsa-miR-3137	CLIP-seq
MIRT2015034	hsa-miR-3145-5p	CLIP-seq
MIRT1063624	hsa-miR-3165	CLIP-seq
MIRT1063625	hsa-miR-3187-5p	CLIP-seq
MIRT1063626	hsa-miR-3190	CLIP-seq
MIRT1063627	hsa-miR-3192	CLIP-seq
MIRT1063628	hsa-miR-3202	CLIP-seq
MIRT1063631	hsa-miR-3614-5p	CLIP-seq
MIRT2015035	hsa-miR-3622a-3p	CLIP-seq
MIRT2015036	hsa-miR-3622b-3p	CLIP-seq
MIRT1063634	hsa-miR-3665	CLIP-seq
MIRT1063636	hsa-miR-3689a-3p	CLIP-seq
MIRT1063637	hsa-miR-3689c	CLIP-seq
MIRT1063638	hsa-miR-3714	CLIP-seq
MIRT1063639	hsa-miR-3913-5p	CLIP-seq
MIRT1063640	hsa-miR-3922-5p	CLIP-seq
MIRT1063641	hsa-miR-3926	CLIP-seq
MIRT1063642	hsa-miR-3929	CLIP-seq
MIRT1063647	hsa-miR-4314	CLIP-seq
MIRT1063648	hsa-miR-4419b	CLIP-seq
MIRT1063649	hsa-miR-4433	CLIP-seq
MIRT1063651	hsa-miR-4459	CLIP-seq
MIRT1063652	hsa-miR-4478	CLIP-seq
MIRT1063653	hsa-miR-4483	CLIP-seq
MIRT1063655	hsa-miR-4533	CLIP-seq
MIRT1063656	hsa-miR-4646-5p	CLIP-seq
MIRT1063659	hsa-miR-4728-5p	CLIP-seq
MIRT1063660	hsa-miR-4733-5p	CLIP-seq
MIRT1063661	hsa-miR-4736	CLIP-seq
MIRT1063663	hsa-miR-4768-3p	CLIP-seq
MIRT1063664	hsa-miR-4786-5p	CLIP-seq
MIRT2015037	hsa-miR-485-5p	CLIP-seq
MIRT2015038	hsa-miR-508-5p	CLIP-seq
MIRT2015039	hsa-miR-520a-5p	CLIP-seq
MIRT2015040	hsa-miR-525-5p	CLIP-seq
MIRT1063665	hsa-miR-548s	CLIP-seq
MIRT1063666	hsa-miR-612	CLIP-seq
MIRT1063667	hsa-miR-627	CLIP-seq
MIRT1063668	hsa-miR-654-3p	CLIP-seq
MIRT1063669	hsa-miR-661	CLIP-seq
MIRT1063670	hsa-miR-665	CLIP-seq
MIRT1063673	hsa-miR-924	CLIP-seq
MIRT1063674	hsa-miR-940	CLIP-seq
MIRT1063613	hsa-miR-1225-3p	CLIP-seq
MIRT1063614	hsa-miR-1228	CLIP-seq
MIRT1063615	hsa-miR-1233	CLIP-seq
MIRT1063618	hsa-miR-1285	CLIP-seq
MIRT1063620	hsa-miR-2114	CLIP-seq
MIRT1063622	hsa-miR-3122	CLIP-seq
MIRT1063623	hsa-miR-3137	CLIP-seq
MIRT2015034	hsa-miR-3145-5p	CLIP-seq
MIRT1063624	hsa-miR-3165	CLIP-seq
MIRT1063625	hsa-miR-3187-5p	CLIP-seq
MIRT1063626	hsa-miR-3190	CLIP-seq
MIRT1063628	hsa-miR-3202	CLIP-seq
MIRT1063629	hsa-miR-323-5p	CLIP-seq
MIRT1063631	hsa-miR-3614-5p	CLIP-seq
MIRT1063632	hsa-miR-3616-3p	CLIP-seq
MIRT2015035	hsa-miR-3622a-3p	CLIP-seq
MIRT2015036	hsa-miR-3622b-3p	CLIP-seq
MIRT1063634	hsa-miR-3665	CLIP-seq
MIRT1063635	hsa-miR-3672	CLIP-seq
MIRT1063636	hsa-miR-3689a-3p	CLIP-seq
MIRT1063637	hsa-miR-3689c	CLIP-seq
MIRT1063638	hsa-miR-3714	CLIP-seq
MIRT1063639	hsa-miR-3913-5p	CLIP-seq
MIRT1063641	hsa-miR-3926	CLIP-seq
MIRT1063642	hsa-miR-3929	CLIP-seq
MIRT1063643	hsa-miR-3934	CLIP-seq
MIRT1063648	hsa-miR-4419b	CLIP-seq
MIRT1063649	hsa-miR-4433	CLIP-seq
MIRT1063650	hsa-miR-4436b-3p	CLIP-seq
MIRT1063651	hsa-miR-4459	CLIP-seq
MIRT1063652	hsa-miR-4478	CLIP-seq
MIRT1063655	hsa-miR-4533	CLIP-seq
MIRT1063657	hsa-miR-4721	CLIP-seq
MIRT1063658	hsa-miR-4722-5p	CLIP-seq
MIRT1063659	hsa-miR-4728-5p	CLIP-seq
MIRT1063660	hsa-miR-4733-5p	CLIP-seq
MIRT1063661	hsa-miR-4736	CLIP-seq
MIRT1063663	hsa-miR-4768-3p	CLIP-seq
MIRT1063664	hsa-miR-4786-5p	CLIP-seq
MIRT2015037	hsa-miR-485-5p	CLIP-seq
MIRT2015038	hsa-miR-508-5p	CLIP-seq
MIRT2015039	hsa-miR-520a-5p	CLIP-seq
MIRT2015040	hsa-miR-525-5p	CLIP-seq
MIRT1063665	hsa-miR-548s	CLIP-seq
MIRT1063666	hsa-miR-612	CLIP-seq
MIRT1063668	hsa-miR-654-3p	CLIP-seq
MIRT1063669	hsa-miR-661	CLIP-seq
MIRT1063670	hsa-miR-665	CLIP-seq
MIRT1063671	hsa-miR-769-5p	CLIP-seq
MIRT1063672	hsa-miR-876-3p	CLIP-seq
MIRT1063674	hsa-miR-940	CLIP-seq
MIRT1063618	hsa-miR-1285	CLIP-seq
MIRT1063619	hsa-miR-1293	CLIP-seq
MIRT1063620	hsa-miR-2114	CLIP-seq
MIRT1063622	hsa-miR-3122	CLIP-seq
MIRT1063623	hsa-miR-3137	CLIP-seq
MIRT1063624	hsa-miR-3165	CLIP-seq
MIRT1063625	hsa-miR-3187-5p	CLIP-seq
MIRT1063626	hsa-miR-3190	CLIP-seq
MIRT1063628	hsa-miR-3202	CLIP-seq
MIRT1063631	hsa-miR-3614-5p	CLIP-seq
MIRT1063634	hsa-miR-3665	CLIP-seq
MIRT1063636	hsa-miR-3689a-3p	CLIP-seq
MIRT1063637	hsa-miR-3689c	CLIP-seq
MIRT1063638	hsa-miR-3714	CLIP-seq
MIRT1063639	hsa-miR-3913-5p	CLIP-seq
MIRT1063641	hsa-miR-3926	CLIP-seq
MIRT1063642	hsa-miR-3929	CLIP-seq
MIRT1063648	hsa-miR-4419b	CLIP-seq
MIRT1063649	hsa-miR-4433	CLIP-seq
MIRT1063651	hsa-miR-4459	CLIP-seq
MIRT1063652	hsa-miR-4478	CLIP-seq
MIRT1063653	hsa-miR-4483	CLIP-seq
MIRT1063655	hsa-miR-4533	CLIP-seq
MIRT1063659	hsa-miR-4728-5p	CLIP-seq
MIRT1063660	hsa-miR-4733-5p	CLIP-seq
MIRT1063661	hsa-miR-4736	CLIP-seq
MIRT1063663	hsa-miR-4768-3p	CLIP-seq
MIRT1063664	hsa-miR-4786-5p	CLIP-seq
MIRT2015037	hsa-miR-485-5p	CLIP-seq
MIRT1063665	hsa-miR-548s	CLIP-seq
MIRT1063666	hsa-miR-612	CLIP-seq
MIRT1063668	hsa-miR-654-3p	CLIP-seq
MIRT1063669	hsa-miR-661	CLIP-seq
MIRT1063674	hsa-miR-940	CLIP-seq
MIRT1063614	hsa-miR-1228	CLIP-seq
MIRT1063620	hsa-miR-2114	CLIP-seq
MIRT1063622	hsa-miR-3122	CLIP-seq
MIRT1063623	hsa-miR-3137	CLIP-seq
MIRT2015034	hsa-miR-3145-5p	CLIP-seq
MIRT1063636	hsa-miR-3689a-3p	CLIP-seq
MIRT1063637	hsa-miR-3689c	CLIP-seq
MIRT1063639	hsa-miR-3913-5p	CLIP-seq
MIRT1063642	hsa-miR-3929	CLIP-seq
MIRT1063648	hsa-miR-4419b	CLIP-seq
MIRT1063652	hsa-miR-4478	CLIP-seq
MIRT1063659	hsa-miR-4728-5p	CLIP-seq
MIRT1063660	hsa-miR-4733-5p	CLIP-seq
MIRT2015037	hsa-miR-485-5p	CLIP-seq
MIRT2015038	hsa-miR-508-5p	CLIP-seq
MIRT2015039	hsa-miR-520a-5p	CLIP-seq
MIRT2015040	hsa-miR-525-5p	CLIP-seq
MIRT1063668	hsa-miR-654-3p	CLIP-seq
MIRT1063614	hsa-miR-1228	CLIP-seq
MIRT2550774	hsa-miR-1283	CLIP-seq
MIRT1063619	hsa-miR-1293	CLIP-seq
MIRT1063620	hsa-miR-2114	CLIP-seq
MIRT1063622	hsa-miR-3122	CLIP-seq
MIRT1063623	hsa-miR-3137	CLIP-seq
MIRT2015034	hsa-miR-3145-5p	CLIP-seq
MIRT1063624	hsa-miR-3165	CLIP-seq
MIRT2550775	hsa-miR-3613-3p	CLIP-seq
MIRT1063631	hsa-miR-3614-5p	CLIP-seq
MIRT2015035	hsa-miR-3622a-3p	CLIP-seq
MIRT2015036	hsa-miR-3622b-3p	CLIP-seq
MIRT1063634	hsa-miR-3665	CLIP-seq
MIRT2550776	hsa-miR-3675-3p	CLIP-seq
MIRT1063636	hsa-miR-3689a-3p	CLIP-seq
MIRT1063637	hsa-miR-3689c	CLIP-seq
MIRT1063638	hsa-miR-3714	CLIP-seq
MIRT1063639	hsa-miR-3913-5p	CLIP-seq
MIRT1063641	hsa-miR-3926	CLIP-seq
MIRT1063642	hsa-miR-3929	CLIP-seq
MIRT1063648	hsa-miR-4419b	CLIP-seq
MIRT2550777	hsa-miR-4421	CLIP-seq
MIRT1063652	hsa-miR-4478	CLIP-seq
MIRT1063653	hsa-miR-4483	CLIP-seq
MIRT1063654	hsa-miR-4505	CLIP-seq
MIRT2550778	hsa-miR-4684-5p	CLIP-seq
MIRT1063659	hsa-miR-4728-5p	CLIP-seq
MIRT1063660	hsa-miR-4733-5p	CLIP-seq
MIRT1063661	hsa-miR-4736	CLIP-seq
MIRT1063662	hsa-miR-4738-3p	CLIP-seq
MIRT1063664	hsa-miR-4786-5p	CLIP-seq
MIRT2015037	hsa-miR-485-5p	CLIP-seq
MIRT2015038	hsa-miR-508-5p	CLIP-seq
MIRT2550779	hsa-miR-548c-3p	CLIP-seq
MIRT1063665	hsa-miR-548s	CLIP-seq
MIRT2550780	hsa-miR-593	CLIP-seq
MIRT1063668	hsa-miR-654-3p	CLIP-seq
MIRT1063674	hsa-miR-940	CLIP-seq
MIRT1063614	hsa-miR-1228	CLIP-seq
MIRT2550774	hsa-miR-1283	CLIP-seq
MIRT1063619	hsa-miR-1293	CLIP-seq
MIRT1063620	hsa-miR-2114	CLIP-seq
MIRT1063622	hsa-miR-3122	CLIP-seq
MIRT1063623	hsa-miR-3137	CLIP-seq
MIRT2015034	hsa-miR-3145-5p	CLIP-seq
MIRT1063624	hsa-miR-3165	CLIP-seq
MIRT2550775	hsa-miR-3613-3p	CLIP-seq
MIRT1063631	hsa-miR-3614-5p	CLIP-seq
MIRT1063634	hsa-miR-3665	CLIP-seq
MIRT2550776	hsa-miR-3675-3p	CLIP-seq
MIRT1063636	hsa-miR-3689a-3p	CLIP-seq
MIRT1063637	hsa-miR-3689c	CLIP-seq
MIRT1063638	hsa-miR-3714	CLIP-seq
MIRT1063639	hsa-miR-3913-5p	CLIP-seq
MIRT1063642	hsa-miR-3929	CLIP-seq
MIRT1063648	hsa-miR-4419b	CLIP-seq
MIRT2550777	hsa-miR-4421	CLIP-seq
MIRT1063649	hsa-miR-4433	CLIP-seq
MIRT1063651	hsa-miR-4459	CLIP-seq
MIRT1063652	hsa-miR-4478	CLIP-seq
MIRT1063653	hsa-miR-4483	CLIP-seq
MIRT2550778	hsa-miR-4684-5p	CLIP-seq
MIRT1063659	hsa-miR-4728-5p	CLIP-seq
MIRT1063660	hsa-miR-4733-5p	CLIP-seq
MIRT1063661	hsa-miR-4736	CLIP-seq
MIRT1063662	hsa-miR-4738-3p	CLIP-seq
MIRT1063663	hsa-miR-4768-3p	CLIP-seq
MIRT1063664	hsa-miR-4786-5p	CLIP-seq
MIRT2015037	hsa-miR-485-5p	CLIP-seq
MIRT2015038	hsa-miR-508-5p	CLIP-seq
MIRT2015039	hsa-miR-520a-5p	CLIP-seq
MIRT2015040	hsa-miR-525-5p	CLIP-seq
MIRT2550779	hsa-miR-548c-3p	CLIP-seq
MIRT2550780	hsa-miR-593	CLIP-seq
MIRT1063668	hsa-miR-654-3p	CLIP-seq
MIRT1063674	hsa-miR-940	CLIP-seq

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0004896	Function	Cytokine receptor activity	IBA	21873635
GO:0004896	Function	Cytokine receptor activity	TAS	8943050
GO:0005143	Function	Interleukin-12 receptor binding	IBA	21873635
GO:0005143	Function	Interleukin-12 receptor binding	IPI	12023369
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IC	8943050
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0016517	Function	Interleukin-12 receptor activity	IDA	8943050
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS	7911493
GO:0019955	Function	Cytokine binding	IBA	21873635
GO:0032729	Process	Positive regulation of interferon-gamma production	IDA	11114383
GO:0032729	Process	Positive regulation of interferon-gamma production	IMP	14635048
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0038155	Process	Interleukin-23-mediated signaling pathway	TAS
GO:0042019	Function	Interleukin-23 binding	IBA	21873635
GO:0042019	Function	Interleukin-23 binding	IPI	12023369
GO:0042020	Function	Interleukin-23 receptor activity	IDA	12023369
GO:0042022	Component	Interleukin-12 receptor complex	IBA	21873635
GO:0042022	Component	Interleukin-12 receptor complex	IDA	12023369
GO:0042104	Process	Positive regulation of activated T cell proliferation	IBA	21873635
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	11114383
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0071346	Process	Cellular response to interferon-gamma	IDA	12023369
GO:0072536	Component	Interleukin-23 receptor complex	IBA	21873635
GO:0072536	Component	Interleukin-23 receptor complex	IDA	12023369
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

MIM	HGNC	e!Ensembl
601604	5971	ENSG00000096996

Protein

UniProt ID

P42701

Protein name

Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)

Protein function

Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Also associates with IL23R to form the interl

PDB

6WDP , 6WDQ , 8C7M , 8ODX , 8OE4 , 8XRP , 8YI7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00041	fn3	447 → 532	Fibronectin type III domain	Domain

Sequence

MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRY
ECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWAR
NQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSP
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
VQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKA
KM

Sequence length

662

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation Pathways in cancer Inflammatory bowel disease		Interleukin-12 signaling Interleukin-23 signaling

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Immunodeficiency	IMMUNODEFICIENCY 30	rs1565678077, rs121908002, rs1421444086, rs1565688667, rs944235493, rs121918314, rs587776713, rs137852678, rs587776714, rs128620188, rs2147483647, rs1569556522, rs137853331, rs137853332, rs179363866 View all (256 more)	12591909, 11424023, 21487897, 9603733, 21057261, 27141500
Liver failure	Liver Failure	rs118203990, rs118203991, rs118203992, rs387907022, rs201861847, rs796065037, rs759315662, rs368196005, rs796052121, rs369437593, rs367683258, rs766314948, rs368085185, rs770446752, rs753039116 View all (10 more)
Osteoporosis	Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Source
Unknown
Celiac disease	Celiac Disease	ClinVar
Cirrhosis	Cirrhosis	ClinVar

Show/Hide Text Mining Associations (63)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	23280621
Anemia Hemolytic	Associate	28266204
Anthrax	Associate	30255293
Arthrogryposis	Associate	21905505, 30255293, 30740107
Asthma	Associate	22325360, 29256176
Autoimmune Diseases	Associate	28266204
Behcet Syndrome	Associate	12932289, 24859272
Bone Diseases Metabolic	Associate	20350312
Breast Neoplasms	Associate	23996684
Bronchopneumonia	Associate	22992471, 23410226
Candidiasis	Associate	21905505, 29025965
Candidiasis Chronic Mucocutaneous	Associate	30627128, 34390440
Candidiasis Oral	Associate	21905505, 29025965, 30627128
Carcinoma Hepatocellular	Stimulate	28732507
Central Nervous System Diseases	Associate	36740310
Cleft Lip	Associate	28266204
Common Variable Immunodeficiency	Stimulate	14616794
Common Variable Immunodeficiency	Associate	33190167
Communicable Diseases	Associate	28266204
COVID 19	Associate	35694544, 36740310
Crohn Disease	Associate	19235914, 19249008
Disease	Associate	28266204
Eczema	Associate	34390440
Eosinophilic enteropathy	Associate	21812800
Hypergammaglobulinemia	Associate	26162572
IgA Deficiency	Associate	21812800
Immunologic Deficiency Syndromes	Associate	21812800, 22992471, 36192705
Infections	Associate	22523911, 29256176
Inflammation	Associate	35694544
Interferon gamma receptor 1 deficiency	Associate	30998751
Interleukin 2 Receptor Alpha Deficiency of	Inhibit	19839503
Interleukin 2 Receptor Alpha Deficiency of	Associate	22992471
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	18591412, 21905505, 28266204, 29025965, 29256176, 30255293, 30740107, 30998751, 33225392, 36740310
Job Syndrome	Associate	34390440
Leiomyoma	Associate	17222831
Liver Cirrhosis Biliary	Associate	20639880
Lymphadenitis	Associate	21905505, 29025965
Lymphoma Non Hodgkin	Associate	21418175
Meningitis Cryptococcal	Associate	22523911
Midline Defects X Linked	Associate	28266204
Musculoskeletal Abnormalities	Associate	34390440
Mycobacterium Infections	Associate	21812800, 36192705
Mycobacterium Infections Nontuberculous	Associate	29256176
Mycoses	Associate	28266204
Neoplasms	Associate	34715892
Neurofibromatosis 1	Associate	19839503
Nocardia Infections	Associate	19839503
Oropharyngeal Neoplasms	Associate	37175405
Osteomyelitis	Associate	30255293
Primary Immunodeficiency Diseases	Associate	26162572, 33225392
Prostatic Neoplasms	Associate	37108754
Purpura Thrombocytopenic Idiopathic	Stimulate	25621490
Salmonella Infections	Associate	19839503, 28266204
Sandhoff Disease	Inhibit	36740310
Sarcoidosis	Associate	36192705
Scleroderma Systemic	Associate	32977850
Severe Acute Respiratory Syndrome	Associate	18478121, 20350312
Sezary Syndrome	Associate	11442758
Status Asthmaticus	Stimulate	15108702
Tangier Disease	Associate	20350312
Tuberculosis	Associate	29256176, 30740107, 30968642, 36740310
Tuberculosis Meningeal	Associate	29256176
Uveomeningoencephalitic Syndrome	Associate	24859272

IL12RB1 (interleukin 12 receptor subunit beta 1)