IL12B (interleukin 12B)

Gene

• Entrez ID: 3593
• Gene name: Interleukin 12B
• Gene symbol: IL12B
• Synonyms (NCBI Gene): CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encode

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT715156	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT715155	hsa-miR-4705	HITS-CLIP	19536157
MIRT715154	hsa-miR-103b	HITS-CLIP	19536157
MIRT715153	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT715152	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT715151	hsa-miR-4284	HITS-CLIP	19536157
MIRT734760	hsa-miR-34a-3p	Microarray, qRT-PCR	33713393
MIRT715156	hsa-miR-3614-3p	HITS-CLIP	19536157
MIRT715155	hsa-miR-4705	HITS-CLIP	19536157
MIRT715154	hsa-miR-103b	HITS-CLIP	19536157
MIRT715153	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT715152	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT715151	hsa-miR-4284	HITS-CLIP	19536157
MIRT1063608	hsa-miR-1207-3p	CLIP-seq
MIRT1063609	hsa-miR-3649	CLIP-seq
MIRT1063610	hsa-miR-3675-3p	CLIP-seq
MIRT1063611	hsa-miR-4716-5p	CLIP-seq
MIRT1063612	hsa-miR-587	CLIP-seq
MIRT2015022	hsa-miR-129-5p	CLIP-seq
MIRT2015023	hsa-miR-1915	CLIP-seq
MIRT2015024	hsa-miR-193a-5p	CLIP-seq
MIRT2015025	hsa-miR-3674	CLIP-seq
MIRT2015026	hsa-miR-4307	CLIP-seq
MIRT2015027	hsa-miR-4436b-5p	CLIP-seq
MIRT2015028	hsa-miR-4720-3p	CLIP-seq
MIRT2015029	hsa-miR-4726-3p	CLIP-seq
MIRT2015030	hsa-miR-4732-5p	CLIP-seq
MIRT2015031	hsa-miR-4804-3p	CLIP-seq
MIRT2015032	hsa-miR-483-5p	CLIP-seq
MIRT2015033	hsa-miR-889	CLIP-seq
MIRT2247354	hsa-miR-1200	CLIP-seq
MIRT2247355	hsa-miR-1343	CLIP-seq
MIRT2247356	hsa-miR-141	CLIP-seq
MIRT2247357	hsa-miR-192	CLIP-seq
MIRT2247358	hsa-miR-200a	CLIP-seq
MIRT2247359	hsa-miR-215	CLIP-seq
MIRT2247360	hsa-miR-219-5p	CLIP-seq
MIRT2247361	hsa-miR-335	CLIP-seq
MIRT2247362	hsa-miR-378g	CLIP-seq
MIRT2247363	hsa-miR-4437	CLIP-seq
MIRT2247364	hsa-miR-4445	CLIP-seq
MIRT2247365	hsa-miR-4674	CLIP-seq
MIRT2247366	hsa-miR-4774-5p	CLIP-seq
MIRT2247367	hsa-miR-4782-3p	CLIP-seq
MIRT2247368	hsa-miR-508-3p	CLIP-seq
MIRT2247369	hsa-miR-548a-3p	CLIP-seq
MIRT2247370	hsa-miR-548e	CLIP-seq
MIRT2247371	hsa-miR-548f	CLIP-seq
MIRT2451701	hsa-miR-1182	CLIP-seq
MIRT2451702	hsa-miR-4778-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EP300	Activation	15482860
ETS2	Unknown	10657616
IRF1	Unknown	10657616
JUN	Activation	14688340
KLF1	Unknown	14976188
NFKB1	Activation	14688340;18690006
NFKB1	Unknown	10657616
REL	Unknown	10657616
RELA	Activation	14688340;18690006
RELA	Unknown	10657616;15270850
SPI1	Unknown	11254706
VDR	Repression	21310195

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001817	Process	Regulation of cytokine production	TAS	1673147
GO:0001912	Process	Positive regulation of leukocyte mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	ISS
GO:0002230	Process	Positive regulation of defense response to virus by host	IDA	12421946
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0002230	Process	Positive regulation of defense response to virus by host	ISS
GO:0002323	Process	Natural killer cell activation involved in immune response	IEA
GO:0002708	Process	Positive regulation of lymphocyte mediated immunity	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IDA	15114670
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	IEA
GO:0002827	Process	Positive regulation of T-helper 1 type immune response	ISS
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IDA	7903063
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	1674604
GO:0005125	Function	Cytokine activity	IDA	7584494
GO:0005125	Function	Cytokine activity	IEA
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005143	Function	Interleukin-12 receptor binding	IBA
GO:0005143	Function	Interleukin-12 receptor binding	TAS	9603733
GO:0005143	Function	Interleukin-12 receptor binding	TAS	1674604
GO:0005515	Function	Protein binding	IPI	7527811, 10899108, 11023671, 11114383, 12023369, 18680750, 29997244
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	7584494
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	TAS	1673147
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	12023369
GO:0008083	Function	Growth factor activity	IDA	1674604
GO:0008283	Process	Cell population proliferation	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010224	Process	Response to UV-B	IDA	8992506
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IDA	7903063
GO:0030101	Process	Natural killer cell activation	IDA	1673147
GO:0031904	Component	Endosome lumen	IEA
GO:0031906	Component	Late endosome lumen	TAS
GO:0032693	Process	Negative regulation of interleukin-10 production	IMP	16751425
GO:0032700	Process	Negative regulation of interleukin-17 production	IDA	16482511
GO:0032725	Process	Positive regulation of granulocyte macrophage colony-stimulating factor production	IDA	20027291
GO:0032729	Process	Positive regulation of type II interferon production	IDA	1674604, 11114383, 19088061, 20027291
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	TAS	1673147
GO:0032733	Process	Positive regulation of interleukin-10 production	IDA	15265908
GO:0032733	Process	Positive regulation of interleukin-10 production	TAS	18675459
GO:0032735	Process	Positive regulation of interleukin-12 production	IDA	20027291
GO:0032740	Process	Positive regulation of interleukin-17 production	IDA	16482511, 16751425, 17888176
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16751425
GO:0032816	Process	Positive regulation of natural killer cell activation	IC	20027291
GO:0032816	Process	Positive regulation of natural killer cell activation	IDA	1674604
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IDA	19088061
GO:0032946	Process	Positive regulation of mononuclear cell proliferation	IMP	11023671
GO:0034105	Process	Positive regulation of tissue remodeling	IC	16482511
GO:0034393	Process	Positive regulation of smooth muscle cell apoptotic process	IDA	16942485
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IBA
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7528775, 7638186, 8943050
GO:0035722	Process	Interleukin-12-mediated signaling pathway	IDA	7584494
GO:0042088	Process	T-helper 1 type immune response	TAS	1673147
GO:0042093	Process	T-helper cell differentiation	IDA	1673147
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IDA	12023369
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IDA	1674604, 11114383
GO:0042110	Process	T cell activation	IEA
GO:0042164	Function	Interleukin-12 alpha subunit binding	IBA
GO:0042164	Function	Interleukin-12 alpha subunit binding	IEA
GO:0042164	Function	Interleukin-12 alpha subunit binding	IPI	11023671
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	7527811
GO:0042832	Process	Defense response to protozoan	IEA
GO:0043382	Process	Positive regulation of memory T cell differentiation	ISS
GO:0043514	Component	Interleukin-12 complex	IBA
GO:0043514	Component	Interleukin-12 complex	IDA	1674604, 11114383
GO:0043514	Component	Interleukin-12 complex	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045063	Process	T-helper 1 cell differentiation	IDA	14688310
GO:0045519	Function	Interleukin-23 receptor binding	IDA	11114383
GO:0045672	Process	Positive regulation of osteoclast differentiation	IDA	17888176
GO:0045785	Process	Positive regulation of cell adhesion	IDA	7903063
GO:0046982	Function	Protein heterodimerization activity	IPI	1674604, 11023671
GO:0048599	Process	Oocyte development	TAS	16772281
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IDA	16942485
GO:0050671	Process	Positive regulation of lymphocyte proliferation	IDA	1674604
GO:0050709	Process	Negative regulation of protein secretion	IGI	30106099
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IC	16482511
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	15114670, 20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IC	20027291
GO:0051135	Process	Positive regulation of NK T cell activation	IDA	19088061
GO:0051142	Process	Positive regulation of NK T cell proliferation	IDA	19088061
GO:0051607	Process	Defense response to virus	IEA
GO:0070743	Component	Interleukin-23 complex	IDA	11114383
GO:0070743	Component	Interleukin-23 complex	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:1900747	Process	Negative regulation of vascular endothelial growth factor signaling pathway	IGI	30106099
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	TAS	20428758
GO:1903588	Process	Negative regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IGI	30106099
GO:2000318	Process	Positive regulation of T-helper 17 type immune response	ISS
GO:2000330	Process	Positive regulation of T-helper 17 cell lineage commitment	ISS

Other IDs

• MIM: 161561
• HGNC: 5970
• e!Ensembl: ENSG00000113302

Protein

• UniProt ID: P29460
• Protein name: Interleukin-12 subunit beta (IL-12B) (Cytotoxic lymphocyte maturation factor 40 kDa subunit) (CLMF p40) (IL-12 subunit p40) (NK cell stimulatory factor chain 2) (NKSF2)
• Protein function: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC. ; Assoc
• PDB: 1F42, 1F45, 3D85, 3D87, 3DUH, 3HMX, 3QWR, 4GRW, 5MJ3, 5MJ4, 5MXA, 5MZV, 5NJD, 6UIB, 6WDQ, 8CR8, 8OE4, 8XRP, 8YI7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10420	IL12p40_C	126 → 216	Cytokine interleukin-12p40 C-terminus	Domain

• Sequence:

  MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
  TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
  KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
  RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
  LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
  RKNASISVRAQDRYYSSSWSEWASVPCS

• Sequence length: 328

Pathways

KEGG:

Cytokine-cytokine receptor interaction
Toll-like receptor signaling pathway
RIG-I-like receptor signaling pathway
C-type lectin receptor signaling pathway
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Alcoholic liver disease
Type I diabetes mellitus
Pertussis
Legionellosis
Leishmaniasis
Chagas disease
African trypanosomiasis
Toxoplasmosis
Amoebiasis
Tuberculosis
Measles
Influenza A
Herpes simplex virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Proteoglycans in cancer
Inflammatory bowel disease
Allograft rejection
Lipid and atherosclerosis

Reactome:

Interleukin-10 signaling
Interleukin-4 and Interleukin-13 signaling
Interleukin-12 signaling
Interleukin-23 signaling

<

Associated diseases

Unknown
Disease merge term	Disease name	Evidence	References	Source
Ankylosing Spondylitis	Ankylosing spondylitis	N/A	N/A	GWAS
Biliary Cholangitis	Primary biliary cholangitis	N/A	N/A	GWAS
Crohn Disease	Crohn's disease or Leprosy (opposite effect), Crohn's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease (MTAG), Inflammatory bowel disease	N/A	N/A	GWAS
Leprosy	Leprosy	N/A	N/A	GWAS
Multiple Sclerosis	Multiple sclerosis	N/A	N/A	GWAS
Psoriasis	Psoriasis	N/A	N/A	GWAS
Psoriasis vulgaris	Psoriasis vulgaris	N/A	N/A	GWAS
Sarcoidosis	Sarcoidosis	N/A	N/A	GWAS
Takayasu Arteritis	Takayasu arteritis	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	31277552
Achondroplasia and Swiss type agammaglobulinemia	Associate	12823285
Acne Vulgaris	Stimulate	38009017
Acquired Immunodeficiency Syndrome	Associate	10419892
Acute Disease	Associate	24696530
Adenocarcinoma	Associate	30785523, 37713401
Adenocarcinoma of Lung	Associate	26264617, 31004093, 34745015, 36157452
Adenocarcinoma of Lung	Inhibit	37658534
Adenoma	Stimulate	17579859
Adenoma	Associate	23442743
Adrenoleukodystrophy	Associate	32359032
Aicardi Goutieres syndrome	Associate	23408864
Allergic Fungal Sinusitis	Associate	26047816
Alzheimer Disease	Associate	26626881, 29070909, 30193587, 33206953
Amyloidosis Hereditary Transthyretin Related	Associate	31253122
Androgen Insensitivity Syndrome	Associate	26196693
Anemia Hemolytic	Associate	20350312, 21819616
Anemia Sickle Cell	Associate	32411797
Angina Stable	Associate	23285065, 29554212
Angina Unstable	Stimulate	23285065
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	15762890
Aortic Valve Insufficiency	Associate	34211061
Arthritis	Associate	26667304, 35095831, 8608632
Arthritis Infectious	Inhibit	18945879
Arthritis Juvenile	Associate	21381000, 37543802
Arthritis Psoriatic	Associate	12841851, 16741508, 18369459, 18800148, 19035472, 20953186, 22298274, 27543964, 35297512, 36995469
Arthritis Rheumatoid	Associate	10233738, 10513808, 12223112, 12571841, 12632414, 15188356, 18369459, 22355377, 25469793, 26149185, 26956410, 27111665, 27896842, 32468016, 34369364, 8608632, 9410920
Arthritis Rheumatoid	Stimulate	27896842
Arthrogryposis	Associate	30255293
Ascites	Inhibit	28327095, 28410380
Ascites	Associate	31440239, 34887625
Asthma	Associate	15322986, 19274925, 20371397, 21103062, 21179211, 24654313, 32017227, 33515711, 33998076, 39380119
Asthma	Inhibit	29515128
Ataxia Telangiectasia	Associate	17100756
Atherosclerosis	Associate	15988104, 34292876, 35052452
Athletic Injuries	Associate	27035221
Attention Deficit Disorder with Hyperactivity	Associate	36904292
Autistic Disorder	Stimulate	23353117
Autoimmune Diseases	Associate	10513814, 18431321, 23830516, 24890729, 25966091
Autoimmune Lymphoproliferative Syndrome	Associate	26113417
Bacterial Infections	Stimulate	14987733
Bacterial Infections	Inhibit	22749533
Behcet Syndrome	Associate	10513814, 15654836, 15654837, 16514412, 16778812, 24859272, 27281077
Behcet Syndrome	Stimulate	15248229, 36333776
Berylliosis	Associate	12449171
Biliary Atresia	Associate	15128911
Bone Diseases	Associate	35617338
Bone Marrow Diseases	Associate	9324294
Brain Neoplasms	Associate	34850166
Breast Neoplasms	Stimulate	18566447, 24568505
Breast Neoplasms	Associate	22618884, 22702905, 24426833, 30814616, 36046784
Bronchopulmonary Dysplasia	Associate	16754651
Burns	Associate	25185059, 35363228
Calcinosis	Associate	10027419
Cancer Pain	Associate	33000216
Carcinoma Hepatocellular	Associate	14726965, 16718852, 19126646, 19194666, 26631030, 26783377, 29568203
Carcinoma Merkel Cell	Inhibit	31582519
Carcinoma Non Small Cell Lung	Associate	21342183, 30278439, 31670094, 35891724
Carcinoma Ovarian Epithelial	Associate	27533245
Carcinoma Pancreatic Ductal	Associate	35836806
Cardiovascular Diseases	Associate	32658258
Carotid Artery Diseases	Associate	32322161
CD59 Deficiency	Associate	17459079, 18045485, 35955723
CD59 Deficiency	Stimulate	23058368
Celiac Disease	Inhibit	15176994
Celiac Disease	Associate	18369459, 34449925
Cerebral Infarction	Associate	28168424
Chest Pain	Associate	23285065
Chlamydia Infections	Associate	16297168
Chlamydial Pneumonia	Associate	22581790
Chromosomal Instability	Associate	25695689
Chromosome 5q Deletion Syndrome	Associate	9339364
Chronic Disease	Associate	10523615, 32974878
Chronic Periodontitis	Associate	21198766, 23592000
Cleft Palate	Associate	22174866
Coinfection	Associate	31858365
Coinfection	Stimulate	33819170
Colitis	Associate	22479607
Colitis Ulcerative	Associate	18438406, 22479607, 25761185, 26177303, 27281077, 31191543, 31206576, 32666631, 33730998
Colitis Ulcerative	Stimulate	30369485
Colorectal Neoplasms	Associate	16101177, 17594499, 26104769, 32149085, 32209656
Colorectal Neoplasms	Inhibit	17579859, 27494857
Colorectal Neoplasms Hereditary Nonpolyposis	Associate	29710228
Common Variable Immunodeficiency	Associate	11966768, 14616794, 16634796, 19592080
Communicable Diseases	Associate	23103228, 25123642, 25613737, 7909320
Condylomata Acuminata	Stimulate	37053156
Congenital disorder of glycosylation type 1A	Associate	33511216
Congenital disorder of glycosylation type 1L	Associate	29589181
Coronary Artery Disease	Associate	40303485
Coronavirus Infections	Stimulate	24725946
COVID 19	Stimulate	32592406, 33819170, 35146763
COVID 19	Associate	33544720, 34061395, 34238985, 36157452, 37057213, 37201409, 37564647
Craniocerebral Trauma	Stimulate	22342787
Crohn Disease	Associate	12594843, 15306590, 16099792, 17682002, 18438406, 19235914, 19249008, 19302707, 21548950, 21752952, 21930071, 22275320, 22479607, 23665963, 25761185, 28269885, 31191543, 32641083, 34198814, 35538558, 39586377, 9060820, 9502407
Cystic Fibrosis	Associate	18026571, 33050003
Cystitis Interstitial	Associate	30973927
Cytokine Release Syndrome	Associate	11753820
Cytokine Release Syndrome	Stimulate	36396738
Cytomegalovirus Infections	Associate	28501927
Dementia	Associate	18631256
Dementia Vascular	Associate	38452989
Depressive Disorder	Associate	32998701
Dermatitis Atopic	Associate	22427475, 28821884, 30286163, 33975024
Dermatitis Atopic	Stimulate	38317432
Dermatitis Atopic 1	Associate	17179689
Dermatomyositis	Associate	36197661
Diabetes Mellitus	Associate	15988104, 25179705, 28127111, 29513874, 34566972, 36903646
Diabetes Mellitus	Stimulate	22385239, 34944529
Diabetes Mellitus Type 1	Associate	19956106, 24677179, 28127111, 32035746
Diabetes Mellitus Type 2	Inhibit	22296201, 34944529
Diabetes Mellitus Type 2	Associate	24086540, 25179705, 34991588, 35482474, 36557031, 38009017
Diabetic Angiopathies	Associate	24463275
DNA Virus Infections	Associate	37474630
Down Syndrome	Associate	33206953
Drug Hypersensitivity	Associate	18782262, 24785110
Drug Related Side Effects and Adverse Reactions	Stimulate	10594688, 12165101
Drug Related Side Effects and Adverse Reactions	Associate	17594499, 22040089, 25695689, 31852717
Duodenal Ulcer	Associate	10655986, 15145461
Ectodermal dysplasia hypohidrotic with immune deficiency	Associate	16794254
Encephalitis Japanese	Stimulate	40536377
Encephalitis Tick Borne	Inhibit	37261350
Encephalocele	Associate	20222111
Encephalomyelitis Autoimmune Experimental	Associate	17979888
Endocarditis	Stimulate	26225421
Endocarditis	Associate	28659664
Endometrial Neoplasms	Stimulate	23051953
Endometriosis	Associate	18295214, 27491770
Enterocolitis	Associate	16754651
Eosinophilia	Associate	19274925
Epstein Barr Virus Infections	Associate	21792887
Erythema Nodosum	Associate	10564558
Erythrocytosis Familial 2	Associate	19062180
Esophageal Neoplasms	Inhibit	25144454
Essential Hypertension	Associate	25945941
Factor XII Deficiency	Associate	11753820
Fallopian Tube Diseases	Associate	22581790, 25565213
Farber Lipogranulomatosis	Associate	22581790
Fatigue Syndrome Chronic	Associate	20447453, 30929860, 37373402
Fever	Associate	25695689
Fibrosis	Inhibit	24757288
Fragile X Tremor Ataxia Syndrome	Stimulate	33285358
Gastritis	Associate	15145461, 24069393, 30382864
Gastrointestinal Neoplasms	Associate	15598979
Gaucher Disease	Associate	32086386
Genetic Diseases Inborn	Associate	30260027
Giant Cell Arteritis	Associate	22147555, 29731755
Glaucoma	Stimulate	22355254, 32043817
Glaucoma Open Angle	Stimulate	22355254
Glaucoma Open Angle	Associate	26820987
Glioblastoma	Associate	34850166
Goiter	Associate	35767887
Granuloma	Associate	18654018
Granulomatosis with Polyangiitis	Stimulate	11982607
Granulomatous Disease Chronic	Associate	30260027
Graves Disease	Associate	16966828, 23164360, 35767887
Graves Ophthalmopathy	Associate	23164360, 27612658, 32086386
Hashimoto Disease	Associate	35767887
Head and Neck Neoplasms	Inhibit	31142501
Helicobacter Infections	Associate	10655986, 17948927
Hemophilia A	Associate	21362111
Hepatitis Autoimmune	Associate	27183637
Hepatitis C	Associate	22711645, 23388728, 25613737
Hepatitis C	Stimulate	26783377
Hepatitis C Chronic	Associate	17634507, 25613737, 36534786
Hepatitis E	Associate	29285885
Hermansky Pudlak syndrome 2	Associate	27207797
Herpes Labialis	Associate	32735468
HIV Infections	Associate	10419892, 15270850, 15753259, 21200019, 22844321, 24139398, 24959961, 26286082, 27555306, 37606991, 8574836, 9521075
HIV Infections	Inhibit	11369647, 15067070, 22902724, 33322496
HIV Infections	Stimulate	37376629
Hodgkin Disease	Associate	18077789, 19738032, 24141626, 31277552, 7718889
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	25179705
Hyperkinesis	Associate	18050195
Hypertension	Associate	27896842, 32322161, 34211061
Hyperthyroidism	Associate	12841851
Hypothyroidism	Inhibit	31350776
Idiopathic Noncirrhotic Portal Hypertension	Associate	21455331
Idiopathic Noncirrhotic Portal Hypertension	Inhibit	34887625
Idiopathic Pulmonary Fibrosis	Associate	17056243
IgA Vasculitis	Associate	26956410
Ige Responsiveness Atopic	Associate	15322986, 17179689, 24654313
Immune Reconstitution Inflammatory Syndrome	Associate	28316373
Immune System Diseases	Associate	10419892, 11298330, 34517836, 40503945, 8574836
Immunoglobulin a deficiency 1	Stimulate	11966768
Immunologic Deficiency Syndromes	Inhibit	15270850
Immunologic Deficiency Syndromes	Associate	28159873, 36069176
Infant Newborn Diseases	Associate	30304723
Infections	Inhibit	11179309, 28127111
Infections	Associate	11753820, 16297168, 16982327, 18417583, 18974890, 22240432, 23429441, 25966091, 32592406, 8574836
Infections	Stimulate	29463209, 37201409
Inflammation	Associate	10027419, 11121048, 12223112, 15286007, 16297168, 16782032, 16966828, 19359411, 19843090, 20460119, 20555352, 20722760, 20956025, 21853262, 22015106, 22702905, 23103228, 23164360, 23338226, 23761327, 23853590, 24344359, 24677179, 24890729, 25123642, 25177683, 25292079, 25451162, 25654296, 26198819, 26382585, 26783377, 26952588, 27142093, 27220776, 27281077, 28028951, 28168424, 28410380, 28432342, 28600552, 28821884, 29304116, 29617527, 30289282, 30637473, 30713533, 30734977, 30788684, 30896871, 31509965, 31567936, 31670094, 31858365, 31921114, 32359032, 32620160, 32867704, 32998701, 33067627, 33256749, 33285358, 33549556, 33552075, 34220803, 35297512, 35547734, 35563587, 35617338, 35751934, 36064356, 36197661, 36419183, 36613673, 36768201, 37049592, 37225144, 37588593, 37606991, 38009017, 38167707, 39586377, 9824341
Inflammation	Inhibit	17179689, 39201794
Inflammation	Stimulate	21771345, 27916909, 35577502, 38317432
Inflammatory Bowel Diseases	Associate	22479607, 22496383, 23028907, 23830516, 25671699, 27281077, 31191543, 32661180, 37279927, 39586377, 9060820
Influenza Human	Stimulate	19276177, 24641803
Influenza Human	Associate	24696530, 29491009, 30131389
Insulin Resistance	Associate	24086540, 38009017
Intervertebral Disc Degeneration	Associate	32620160
Intestinal Diseases	Associate	15654837
Intracranial Aneurysm	Associate	33511216
Intrahepatic Cholestasis of Pregnancy	Stimulate	24489901
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	18591412, 23036270, 29589181, 29725107, 30255293, 34517836, 36069176
Invasive Pulmonary Aspergillosis	Associate	40503945
Irritable Bowel Syndrome	Associate	22816602
Job Syndrome	Associate	21792878
Joint Diseases	Associate	25469793
Keratitis Dendritic	Associate	22902724
Keratitis Herpetic	Associate	32867704
Keratoconus	Associate	39390037
Kidney Failure Chronic	Associate	28651949
Laryngeal Neoplasms	Associate	25719218
Leishmaniasis	Associate	25123642
Leprosy	Associate	11292765, 15976343, 23103228, 24578538, 32421744, 33819170
Leprosy Tuberculoid	Associate	11441083, 33819170
Leukemia	Associate	10458772, 16338495, 38167707
Leukemia Lymphocytic Chronic B Cell	Associate	35328450
Leukemia Lymphoma Adult T Cell	Associate	20858854
Leukemia Myeloid Acute	Associate	16338495, 25757160, 32349161
Leukoencephalopathies	Associate	33285358
Listeriosis	Associate	25123642
Liver Cirrhosis Biliary	Associate	19458352, 24375552, 24648611, 28922472, 38228248
Liver Diseases	Associate	26783377
Liver Failure	Associate	25695689, 32884227
Lung Diseases	Associate	17567674, 24696530, 34960806
Lung Neoplasms	Associate	19124500, 24568466
Lupus Erythematosus Systemic	Associate	11014347, 11359450, 18795942, 19838195, 26808113, 27059274, 27110576, 29475858, 31007604, 37543802
Lupus Erythematosus Systemic	Stimulate	11342672, 15498048, 31871930, 35444657
Lupus Nephritis	Associate	17324967, 18163476, 18795942, 19021013, 37460249
Lupus Vasculitis Central Nervous System	Associate	40348638
Lymphatic Metastasis	Associate	17461482
Lymphoma	Associate	10390194, 18050195
Lymphoma B Cell	Associate	22426209
Lymphoma Follicular	Associate	17327408, 7718889
Lymphoma Large B Cell Diffuse	Inhibit	40222457
Lymphoma Non Hodgkin	Associate	19606255, 27797254
Lymphoma Primary Effusion	Associate	21792887
Lymphoma T Cell	Associate	26268241
Lymphoma T Cell Cutaneous	Inhibit	11442758
Lymphoma T Cell Cutaneous	Associate	11841558
Lymphoproliferative Disorders	Associate	7718889
Lymphoproliferative Syndrome X Linked 2	Stimulate	32514016
Malaria	Associate	20003322, 20350312, 21819616
Malaria Cerebral	Associate	20003322
Malaria Falciparum	Associate	21819616
Malnutrition	Inhibit	23429441
Melanoma	Associate	10382738, 16801397, 18684935, 25695689, 25848976, 25889680, 30326165, 31703593, 35302641, 36610941, 39222576, 8706345, 9067406
Meningitis Bacterial	Stimulate	11985531
Mesothelioma Malignant	Associate	25162674
Metabolic Syndrome	Inhibit	20384863
Multiple Myeloma	Associate	15180863
Multiple Sclerosis	Stimulate	12562396, 27916909, 7500044, 9652827
Multiple Sclerosis	Associate	15988104, 17900307, 17979888, 18431321, 20837847, 21622858, 23787171, 25690155, 32253768, 32457139, 33285358, 39201794, 8833901, 9012830, 9710434
Myalgia	Associate	27896842
Mycobacterium Infections	Associate	34134458
Mycobacterium Infections Nontuberculous	Associate	23036270, 33176707, 34517836, 36069176
Mycoses	Associate	22195034
Myelodysplastic Syndromes	Associate	33050756, 9324294
Myeloproliferative Syndrome Transient	Stimulate	11966768
Myocardial Infarction	Stimulate	23285065
Myocarditis	Associate	38521068
Myositis Inclusion Body	Stimulate	24594700
Nasal Polyps	Associate	26239551
Negative rheumatoid factor polyarthritis	Associate	25469793
Neoplasm Invasiveness	Associate	16101177
Neoplasm Metastasis	Associate	17461482
Neoplasm Metastasis	Inhibit	26104769
Neoplasm Residual	Associate	27682210
Neoplasms	Associate	10431691, 10606961, 11401027, 11859116, 12536238, 14738463, 14740176, 15217509, 16101177, 16718852, 17177206, 17222831, 17261184, 18385764, 18566447, 19638292, 22021067, 22082029, 22576348, 23280621, 24498025, 25292079, 25695689, 25789858, 25888634, 26264617, 26838097, 27314913, 27494881, 30081891, 30131389, 31004093, 32417134, 34581419, 34745015, 35377948, 35563587, 36064356, 36529525, 36600652, 38087324, 38126032, 38169917, 38278031, 39985498, 9649208, 9823783, 9888462
Neoplasms	Inhibit	12946268, 15515423, 21597388, 24656965, 25123642, 26104769, 31582519, 31852717, 35302641, 35535423, 37658534
Neoplasms	Stimulate	24568466
Neoplasms Adipose Tissue	Associate	22897389
Nephritis	Associate	37543802
Nerve Degeneration	Associate	19302707
Nervous System Diseases	Associate	32038109
Neuroblastoma	Inhibit	30629318
Neuroblastoma	Associate	38167707
Neutrophilia Hereditary	Associate	26047816
Norrie disease	Stimulate	35733062
Nose Diseases	Associate	33919374
Obesity	Stimulate	24568505
Obesity	Inhibit	27494857
Obesity Abdominal	Associate	28103807
Oral Ulcer	Associate	37369724
Osteoporosis	Associate	36755691
Osteosarcoma	Associate	10849374
Ovarian Hyperstimulation Syndrome	Associate	26823856
Ovarian Neoplasms	Associate	22021067, 25081699, 39985498
Ovarian Neoplasms	Inhibit	28327095
Overweight	Associate	25710036
Pain	Associate	27682210
Pancreatic Neoplasms	Associate	19798410
Pancreatitis	Associate	28293095
Papillomavirus Infections	Inhibit	31567936
Paracoccidioidomycosis	Associate	31572394
Parkinson Disease	Stimulate	27220776
Parkinson Disease	Associate	37834363
Pemphigus	Associate	16946717
Peptic Ulcer	Associate	10655986
Periodic fever familial autosomal dominant	Stimulate	35577502
Periodontitis	Associate	23592000, 29054963
Peripheral Nervous System Diseases	Associate	37426324
Peritoneal Neoplasms	Associate	18076766
Persian Gulf Syndrome	Associate	23800166
Persistent Infection	Associate	32408187
Plaque Amyloid	Associate	29070909
Pleural Effusion	Associate	27586092
Pneumococcal Infections	Associate	26956584
Pneumonia	Associate	16754651
Polycystic Kidney Autosomal Dominant	Associate	39768851
Polycystic Ovary Syndrome	Associate	32323770
Polycythemia Vera	Associate	22965887, 24463275
Polyposis Syndrome Hereditary Mixed 1	Associate	17579859
Polyps	Associate	27468819, 29109117
Posterior Leukoencephalopathy Syndrome	Associate	11292765
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12930376
Primary Graft Dysfunction	Stimulate	18573422
Primary Immunodeficiency Diseases	Associate	15334201
Primary Myelofibrosis	Associate	21442636
Prostatic Neoplasms	Stimulate	26047319
Prostatic Neoplasms	Associate	26047319, 32999046, 33678520, 38087324
Prostatitis	Associate	25177683
Protein Energy Malnutrition	Associate	38017491
Prurigo	Stimulate	36806647
Psoriasis	Associate	18369459, 18614543, 18800148, 19035472, 19169254, 22298274, 22897389, 23830516, 27670765, 31509228, 35297512, 35482474, 35563587
Pulmonary Disease Chronic Obstructive	Associate	17996064, 19279357, 22734699, 32017227
Purpura Thrombocytopenic Idiopathic	Associate	26111958
Q Fever	Associate	27876593
Reflex Sympathetic Dystrophy	Associate	19380284
Renal Insufficiency Chronic	Associate	38017491
Respiratory Tract Infections	Inhibit	30193587
Rheumatoid Nodule	Associate	12571841
Rhinitis Allergic	Associate	19274925, 26196693
Salivary Gland Diseases	Associate	18050195
Salmonella Infections	Associate	29523850
Sarcoidosis	Associate	17827837, 18654018, 20851927, 26051272, 27460362
Schizophrenia	Associate	29803226, 32038109, 39566744
Scleroderma Systemic	Associate	27111665
Scrub Typhus	Inhibit	34276693
Sepsis	Associate	34134458, 34566996
Serum Sickness	Inhibit	34299123
Severe Acute Respiratory Syndrome	Associate	20350312, 21819616
Severe Dengue	Inhibit	25589894
Severe Dengue	Stimulate	37696512
Sezary Syndrome	Associate	15315967, 9649208
Shock Septic	Associate	9808181
Sjogren's Syndrome	Associate	10690174, 18050195, 19700754, 27142093, 31281310, 34295332
Sjogren's Syndrome	Stimulate	29846789
Skin Neoplasms	Associate	35535423
Small Cell Lung Carcinoma	Associate	10431691
Spondylitis Ankylosing	Associate	21743469, 26103568
Spondylitis Ankylosing	Stimulate	39185422
Squamous Cell Carcinoma of Head and Neck	Associate	18547033, 35267186, 36529525
Squamous Cell Carcinoma of Head and Neck	Inhibit	31142501
Squamous Cell Carcinoma of Head and Neck	Stimulate	37505766
Squamous Intraepithelial Lesions	Associate	9472685
Squamous Intraepithelial Lesions	Stimulate	9717966
ST Elevation Myocardial Infarction	Stimulate	32198366
Staphylococcal Infections	Stimulate	26225421
Status Asthmaticus	Associate	15322986, 17127048, 23600543, 31187518
Still's Disease Adult Onset	Associate	39376199
Stomach Neoplasms	Associate	15515423, 17461482, 18505066, 28596683, 30223387
Stress Disorders Post Traumatic	Stimulate	30777365
Stroke	Associate	22167233
Syndrome	Associate	23028541
Synovial Cyst	Associate	10513808
Takayasu Arteritis	Associate	23830516, 23830517, 26996483, 28756073, 28874185, 34211061
talaromycosis	Associate	31572394
Thrombocytopenia	Associate	25589894
Thyroiditis	Inhibit	31350776
Triple Negative Breast Neoplasms	Associate	35377948
Tuberculosis	Associate	15295696, 22749533, 23486418, 26073153, 26942285, 34517836, 35305574, 7909320
Tuberculosis	Inhibit	32296431
Tuberculosis	Stimulate	8606100
Tuberculosis Meningeal	Associate	27031950, 37376629
Tuberculosis Pleural	Stimulate	17005928
Tuberculosis Pleural	Associate	21711347
Tuberculosis Pulmonary	Associate	18848499, 21339808, 22771610, 29686169
Tyrosine Kinase 2 Deficiency	Stimulate	29725107
Ulcer	Associate	37536941
Urinary Bladder Neoplasms	Associate	25292079
Uterine Cervical Diseases	Associate	9472685
Uterine Cervical Dysplasia	Inhibit	23521696
Uterine Cervical Neoplasms	Associate	17177206, 18288269, 22614250, 23280621, 34581419
Uterine Diseases	Stimulate	26586929
Uveitis	Stimulate	35061677
Uveomeningoencephalitic Syndrome	Associate	24859272
Vaginosis Bacterial	Stimulate	17652029
Vascular Diseases	Associate	34292876
Vascular System Injuries	Associate	34211061
Vasculitis	Associate	36797040
Vesicular Stomatitis	Associate	28931520
Virus Diseases	Associate	26304966, 26631030, 29725107, 32108047
Virus Diseases	Inhibit	32867704
Vulvar Neoplasms	Associate	26241630
Wounds and Injuries	Associate	8621803