Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3590
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 11 receptor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL11RA
Synonyms (NCBI Gene) Gene synonyms aliases	CRSDA
Disease Acronyms (UniProt) Disease acronyms from UniProt database	CRSDA
Chromosome Chromosome number	9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	9p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Interleukin 11 is a stromal cell-derived cytokine that belongs to a family of pleiotropic and redundant cytokines that use the gp130 transducing subunit in their high affinity receptors. This gene encodes the IL-11 receptor, which is a member of the hemat

Show/Hide all(5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387906784	C>T	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs387906785	C>G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs387906786	C>A,G	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs387906787	C>G,T	Pathogenic	Stop gained, missense variant, non coding transcript variant, coding sequence variant
rs1470928377	G>A	Likely-pathogenic	Missense variant, non coding transcript variant, initiator codon variant

Show/Hide all(45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004237	hsa-miR-346	Microarray	16822819
MIRT2437786	hsa-miR-4643	CLIP-seq
MIRT2550759	hsa-miR-3145-5p	CLIP-seq
MIRT2550760	hsa-miR-323-3p	CLIP-seq
MIRT2550761	hsa-miR-329	CLIP-seq
MIRT2550762	hsa-miR-362-3p	CLIP-seq
MIRT2550763	hsa-miR-377	CLIP-seq
MIRT2550764	hsa-miR-3941	CLIP-seq
MIRT2550765	hsa-miR-4468	CLIP-seq
MIRT2437786	hsa-miR-4643	CLIP-seq
MIRT2550766	hsa-miR-466	CLIP-seq
MIRT2550767	hsa-miR-4672	CLIP-seq
MIRT2550768	hsa-miR-4717-3p	CLIP-seq
MIRT2550769	hsa-miR-4789-3p	CLIP-seq
MIRT2550770	hsa-miR-4802-3p	CLIP-seq
MIRT2550771	hsa-miR-502-5p	CLIP-seq
MIRT2550772	hsa-miR-603	CLIP-seq
MIRT2550773	hsa-miR-642b	CLIP-seq
MIRT2437786	hsa-miR-4643	CLIP-seq
MIRT2550759	hsa-miR-3145-5p	CLIP-seq
MIRT2550760	hsa-miR-323-3p	CLIP-seq
MIRT2682726	hsa-miR-326	CLIP-seq
MIRT2550761	hsa-miR-329	CLIP-seq
MIRT2682727	hsa-miR-330-5p	CLIP-seq
MIRT2682728	hsa-miR-342-5p	CLIP-seq
MIRT2550762	hsa-miR-362-3p	CLIP-seq
MIRT2550763	hsa-miR-377	CLIP-seq
MIRT2550764	hsa-miR-3941	CLIP-seq
MIRT2682729	hsa-miR-4257	CLIP-seq
MIRT2550765	hsa-miR-4468	CLIP-seq
MIRT2437786	hsa-miR-4643	CLIP-seq
MIRT2682730	hsa-miR-4651	CLIP-seq
MIRT2550766	hsa-miR-466	CLIP-seq
MIRT2682731	hsa-miR-4664-5p	CLIP-seq
MIRT2682732	hsa-miR-4667-5p	CLIP-seq
MIRT2550767	hsa-miR-4672	CLIP-seq
MIRT2682733	hsa-miR-4700-5p	CLIP-seq
MIRT2550768	hsa-miR-4717-3p	CLIP-seq
MIRT2550769	hsa-miR-4789-3p	CLIP-seq
MIRT2550770	hsa-miR-4802-3p	CLIP-seq
MIRT2550771	hsa-miR-502-5p	CLIP-seq
MIRT2550772	hsa-miR-603	CLIP-seq
MIRT2682734	hsa-miR-608	CLIP-seq
MIRT2682735	hsa-miR-637	CLIP-seq
MIRT2550773	hsa-miR-642b	CLIP-seq

Show/Hide all(17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	7670098
GO:0004896	Function	Cytokine receptor activity	IBA	21873635
GO:0004921	Function	Interleukin-11 receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	7670098
GO:0008284	Process	Positive regulation of cell population proliferation	IBA	21873635
GO:0009897	Component	External side of plasma membrane	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA	21873635
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0019955	Function	Cytokine binding	IBA	21873635
GO:0019970	Function	Interleukin-11 binding	IBA	21873635
GO:0032502	Process	Developmental process	IMP	21741611
GO:0038154	Process	Interleukin-11-mediated signaling pathway	IEA
GO:0043235	Component	Receptor complex	IBA	21873635
GO:0060322	Process	Head development	IMP	21741611

MIM	HGNC	e!Ensembl
600939	5967	ENSG00000137070

Protein

UniProt ID

Q14626

Protein name

Interleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL-11R-alpha) (IL-11RA) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]

Protein function

Receptor for interleukin-11 (IL11). The receptor systems for IL6, LIF, OSM, CNTF, IL11 and CT1 can utilize IL6ST for initiating signal transmission. The IL11/IL11RA/IL6ST complex may be involved in the control of proliferation and/or differentia

PDB

6O4P , 8DPS , 8DPT , 8DPU , 8QY4

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in a number of cell lines, including the myelogenous leukemia cell line K-562, the megakaryocytic leukemia cell line M-07e, the erythroleukemia cell line TF-1, and the osteosarcoma cell lines, MG-63 and SaOS-2 (PubMed:7670098

Sequence

MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF
RDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHR
DSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP
NL

Sequence length

422

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Hematopoietic cell lineage		IL-6-type cytokine receptor ligand interactions

Show/Hide Causal Diseases (4)

Disease term	Disease name	dbSNP ID	References
Causal
Coronal craniosynostosis	Coronal craniosynostosis	rs1566992093
Craniosynostosis	Craniosynostosis	rs104893895, rs587777006, rs587777007, rs587777008, rs587777010, rs864321680, rs864321681, rs1057517670, rs1064794325, rs1555750816, rs1599823350
Craniosynostosis and dental anomalies	CRANIOSYNOSTOSIS AND DENTAL ANOMALIES, Craniosynostosis-dental anomalies	rs387906784, rs387906785, rs387906786, rs387906787	21741611, 24498618
Ovarian cancer	Malignant neoplasm of ovary	rs34424986, rs137853060, rs28934575, rs79658334, rs121913021, rs62625308, rs80356898, rs80357579, rs41293497, rs80356904, rs80357471, rs80357522, rs80357234, rs80357912, rs80357828 View all (31 more)	11161848

Show/Hide Text Mining Associations (29)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	34301211
Adenoma	Associate	31280266
Arthritis Psoriatic	Associate	16622521
Arthritis Rheumatoid	Associate	29327326
Bicuspid Aortic Valve Disease	Associate	36071494
Bone Diseases	Associate	28143986
Breast Neoplasms	Associate	28143986
Carcinoma Hepatocellular	Associate	29901200
Colonic Neoplasms	Associate	16482637
Colorectal Neoplasms	Associate	16482637
Craniofacial Dysostosis	Associate	35331937
Craniosynostoses	Associate	27884935, 35331937, 37596289, 37994264, 38329021
Endometrial Neoplasms	Associate	20008143
Glioblastoma	Associate	36834778
Hereditary leiomyomatosis and renal cell cancer	Associate	16291580
Infections	Associate	34831321
Intestinal Neoplasms	Associate	16482637
Lymphoma Follicular	Associate	16291580
Lymphoma Large B Cell Diffuse	Associate	16291580
Melanoma	Associate	37240247
Neoplasm Metastasis	Stimulate	37240247
Neoplasms	Associate	16482637, 17712417, 18941632, 20553623, 36238304, 40755754
Osteosarcoma	Associate	23144859
Prostatic Neoplasms	Associate	17712417
Prostatitis	Stimulate	11141475, 17712417
Skull Fractures	Associate	37994264
Stomach Neoplasms	Associate	27920471
Temporomandibular Joint Dysfunction Syndrome	Associate	33893371
Urinary Bladder Neoplasms	Associate	40755754

IL11RA (interleukin 11 receptor subunit alpha)