Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3586
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 10
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL10
Synonyms (NCBI Gene) Gene synonyms aliases	CSIF, GVHDS, IL-10, IL10A, TGIF
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1q32.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cytokine produced primarily by monocytes and to a lesser extent by lymphocytes. This cytokine has pleiotropic effects in immunoregulation and inflammation. It down-regulates the expression of Th1 cytokines, MHC class

Show/Hide all(231)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005082	hsa-miR-106a-5p	Luciferase reporter assay, qRT-PCR	19307576
MIRT054365	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR	22835429
MIRT054365	hsa-let-7c-5p	Luciferase reporter assay, qRT-PCR	22835429
MIRT731372	hsa-miR-194-5p	Luciferase reporter assay, Microarray, qRT-PCR	26147452
MIRT731372	hsa-miR-194-5p	Luciferase reporter assay, Microarray, qRT-PCR	26147452
MIRT734608	hsa-miR-1-3p	qRT-PCR, Flow cytometry	33584638
MIRT734609	hsa-miR-20a-3p	qRT-PCR, Flow cytometry	33584638
MIRT734610	hsa-miR-28-3p	qRT-PCR, Flow cytometry	33584638
MIRT734611	hsa-miR-95-3p	qRT-PCR, Flow cytometry	33584638
MIRT734612	hsa-miR-146a-3p	qRT-PCR, Flow cytometry	33584638
MIRT734613	hsa-miR-335-3p	qRT-PCR, Flow cytometry	33584638
MIRT734614	hsa-miR-625-3p	qRT-PCR, Flow cytometry	33584638
MIRT736457	hsa-miR-3928-5p	Western blotting, qRT-PCR	33125125
MIRT736491	hsa-miR-21-3p	Immunofluorescence, qRT-PCR, ELISA	33110923
MIRT756216	hsa-miR-374b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	36437465
MIRT1063421	hsa-miR-106a	CLIP-seq
MIRT1063422	hsa-miR-106b	CLIP-seq
MIRT1063423	hsa-miR-1236	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063428	hsa-miR-17	CLIP-seq
MIRT1063429	hsa-miR-20a	CLIP-seq
MIRT1063430	hsa-miR-20b	CLIP-seq
MIRT1063431	hsa-miR-302a	CLIP-seq
MIRT1063432	hsa-miR-302b	CLIP-seq
MIRT1063433	hsa-miR-302c	CLIP-seq
MIRT1063434	hsa-miR-302d	CLIP-seq
MIRT1063435	hsa-miR-302e	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063440	hsa-miR-372	CLIP-seq
MIRT1063441	hsa-miR-373	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT1063444	hsa-miR-3914	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063446	hsa-miR-4270	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063449	hsa-miR-4441	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT1063451	hsa-miR-4668-5p	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063454	hsa-miR-4731-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063456	hsa-miR-4753-3p	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT1063458	hsa-miR-4768-5p	CLIP-seq
MIRT1063459	hsa-miR-496	CLIP-seq
MIRT1063460	hsa-miR-512-3p	CLIP-seq
MIRT1063461	hsa-miR-519d	CLIP-seq
MIRT1063462	hsa-miR-520a-3p	CLIP-seq
MIRT1063463	hsa-miR-520b	CLIP-seq
MIRT1063464	hsa-miR-520c-3p	CLIP-seq
MIRT1063465	hsa-miR-520d-3p	CLIP-seq
MIRT1063466	hsa-miR-520e	CLIP-seq
MIRT1063467	hsa-miR-520g	CLIP-seq
MIRT1063468	hsa-miR-520h	CLIP-seq
MIRT1063469	hsa-miR-570	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT1063472	hsa-miR-93	CLIP-seq
MIRT1550094	hsa-miR-1	CLIP-seq
MIRT1550095	hsa-miR-206	CLIP-seq
MIRT1550096	hsa-miR-3155	CLIP-seq
MIRT1550097	hsa-miR-3155b	CLIP-seq
MIRT1550098	hsa-miR-3673	CLIP-seq
MIRT1550099	hsa-miR-484	CLIP-seq
MIRT1550100	hsa-miR-613	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014984	hsa-miR-3194-3p	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT2014986	hsa-miR-431	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2014990	hsa-miR-4797-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT2014994	hsa-miR-924	CLIP-seq
MIRT1063421	hsa-miR-106a	CLIP-seq
MIRT1063422	hsa-miR-106b	CLIP-seq
MIRT1063424	hsa-miR-1245	CLIP-seq
MIRT2247336	hsa-miR-129-5p	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT1063428	hsa-miR-17	CLIP-seq
MIRT1063429	hsa-miR-20a	CLIP-seq
MIRT1063430	hsa-miR-20b	CLIP-seq
MIRT1063431	hsa-miR-302a	CLIP-seq
MIRT1063432	hsa-miR-302b	CLIP-seq
MIRT1063433	hsa-miR-302c	CLIP-seq
MIRT1063434	hsa-miR-302d	CLIP-seq
MIRT1063435	hsa-miR-302e	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014984	hsa-miR-3194-3p	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2247337	hsa-miR-3672	CLIP-seq
MIRT1063440	hsa-miR-372	CLIP-seq
MIRT1063441	hsa-miR-373	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT2014986	hsa-miR-431	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063454	hsa-miR-4731-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063456	hsa-miR-4753-3p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2247339	hsa-miR-5095	CLIP-seq
MIRT1063460	hsa-miR-512-3p	CLIP-seq
MIRT1063461	hsa-miR-519d	CLIP-seq
MIRT1063462	hsa-miR-520a-3p	CLIP-seq
MIRT1063463	hsa-miR-520b	CLIP-seq
MIRT1063464	hsa-miR-520c-3p	CLIP-seq
MIRT1063465	hsa-miR-520d-3p	CLIP-seq
MIRT1063466	hsa-miR-520e	CLIP-seq
MIRT1063467	hsa-miR-520g	CLIP-seq
MIRT1063468	hsa-miR-520h	CLIP-seq
MIRT2247340	hsa-miR-552	CLIP-seq
MIRT2247341	hsa-miR-562	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063470	hsa-miR-640	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT2014994	hsa-miR-924	CLIP-seq
MIRT1063472	hsa-miR-93	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT2437783	hsa-miR-4263	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT2437784	hsa-miR-4799-5p	CLIP-seq
MIRT2437785	hsa-miR-576-5p	CLIP-seq
MIRT1063427	hsa-miR-1587	CLIP-seq
MIRT1063439	hsa-miR-369-3p	CLIP-seq
MIRT1063442	hsa-miR-374a	CLIP-seq
MIRT1063443	hsa-miR-374b	CLIP-seq
MIRT2437783	hsa-miR-4263	CLIP-seq
MIRT1063452	hsa-miR-4674	CLIP-seq
MIRT2437784	hsa-miR-4799-5p	CLIP-seq
MIRT2437785	hsa-miR-576-5p	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2451691	hsa-miR-577	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT1063425	hsa-miR-1321	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063447	hsa-miR-4419a	CLIP-seq
MIRT1063450	hsa-miR-4510	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT1063455	hsa-miR-4739	CLIP-seq
MIRT1063457	hsa-miR-4756-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2451691	hsa-miR-577	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT1063471	hsa-miR-877	CLIP-seq
MIRT2550753	hsa-miR-1343	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT2550754	hsa-miR-1976	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2550755	hsa-miR-498	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2550756	hsa-miR-891b	CLIP-seq
MIRT2550753	hsa-miR-1343	CLIP-seq
MIRT1063426	hsa-miR-150	CLIP-seq
MIRT2014982	hsa-miR-197	CLIP-seq
MIRT2550754	hsa-miR-1976	CLIP-seq
MIRT1063436	hsa-miR-3074-3p	CLIP-seq
MIRT1063437	hsa-miR-3135b	CLIP-seq
MIRT2014983	hsa-miR-3149	CLIP-seq
MIRT1063438	hsa-miR-3652	CLIP-seq
MIRT2014985	hsa-miR-411	CLIP-seq
MIRT1063445	hsa-miR-4253	CLIP-seq
MIRT1063448	hsa-miR-4430	CLIP-seq
MIRT1063453	hsa-miR-4688	CLIP-seq
MIRT2014987	hsa-miR-4716-5p	CLIP-seq
MIRT2014988	hsa-miR-4735-5p	CLIP-seq
MIRT2682724	hsa-miR-4772-3p	CLIP-seq
MIRT2014989	hsa-miR-4775	CLIP-seq
MIRT2247338	hsa-miR-4783-5p	CLIP-seq
MIRT2014991	hsa-miR-483-5p	CLIP-seq
MIRT2550755	hsa-miR-498	CLIP-seq
MIRT2247339	hsa-miR-5095	CLIP-seq
MIRT2014992	hsa-miR-5096	CLIP-seq
MIRT2247340	hsa-miR-552	CLIP-seq
MIRT2014993	hsa-miR-590-3p	CLIP-seq
MIRT2247342	hsa-miR-764	CLIP-seq
MIRT2550756	hsa-miR-891b	CLIP-seq

Transcription factors

Show/Hide all(27)

Transcription factor	Regulation	Reference
ATF1	Activation	10540320
CEBPA	Unknown	12219016
CEBPB	Unknown	12493739
CREB1	Activation	10540320;22140263
CREB1	Unknown	17202341
FLI1	Activation	20879862
FOXP3	Unknown	24315995
GATA3	Unknown	21507199
HDAC11	Repression	19011628
HDAC4	Repression	17610967
IRF1	Activation	12817009
IRF8	Unknown	20709027
MSC	Activation	19561533
NFKB1	Activation	19124729
NFKB1	Unknown	9310124
NR1I2	Activation	22285937
PARP1	Unknown	20181890
PGR	Repression	18685848
REL	Unknown	9310124
RELA	Activation	19124729
SP1	Activation	21309719
SP1	Unknown	11278848;17202341
STAT1	Unknown	20709027
STAT3	Activation	12817009;18765795
STAT3	Unknown	10903771;15034082;17404037;18403020;19124156
TBX21	Unknown	21507199
VDR	Repression	20691220

Show/Hide all(86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IDA	1940799
GO:0001819	Process	Positive regulation of cytokine production	IDA	10443688
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IEA
GO:0002237	Process	Response to molecule of bacterial origin	IDA	17449476
GO:0002639	Process	Positive regulation of immunoglobulin production	IGI	22962438
GO:0002719	Process	Negative regulation of cytokine production involved in immune response	IDA	10443688
GO:0002875	Process	Negative regulation of chronic inflammatory response to antigenic stimulus	IEA
GO:0002904	Process	Positive regulation of B cell apoptotic process	IDA	9184696
GO:0005125	Function	Cytokine activity	NAS	10443688
GO:0005141	Function	Interleukin-10 receptor binding	NAS	1847510
GO:0005515	Function	Protein binding	IPI	11485736, 12513909, 15837194, 16982608, 20462497, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	10443688, 21323571
GO:0007253	Process	Cytoplasmic sequestering of NF-kappaB	NAS	10975994
GO:0007568	Process	Aging	IEA
GO:0008083	Function	Growth factor activity	NAS	1371884
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0010468	Process	Regulation of gene expression	IDA	9184696
GO:0010507	Process	Negative regulation of autophagy	IDA	26962683
GO:0014823	Process	Response to activity	IEA
GO:0014854	Process	Response to inactivity	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0030097	Process	Hemopoiesis	TAS	11244051
GO:0030183	Process	B cell differentiation	NAS	8228801
GO:0030595	Process	Leukocyte chemotaxis	TAS	9405662
GO:0030886	Process	Negative regulation of myeloid dendritic cell activation	IEA
GO:0030889	Process	Negative regulation of B cell proliferation	IDA	9184696
GO:0032687	Process	Negative regulation of interferon-alpha production	NAS	9637497
GO:0032689	Process	Negative regulation of interferon-gamma production	IEA
GO:0032692	Process	Negative regulation of interleukin-1 production	TAS	19262501
GO:0032695	Process	Negative regulation of interleukin-12 production	TAS	19262501
GO:0032701	Process	Negative regulation of interleukin-18 production	TAS	19262501
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	10443688
GO:0032715	Process	Negative regulation of interleukin-6 production	TAS	19262501
GO:0032717	Process	Negative regulation of interleukin-8 production	TAS	19262501
GO:0032720	Process	Negative regulation of tumor necrosis factor production	TAS	19262501
GO:0032868	Process	Response to insulin	IEA
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	ISS
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	ISS
GO:0034465	Process	Response to carbon monoxide	IEA
GO:0035722	Process	Interleukin-12-mediated signaling pathway	TAS
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IEA
GO:0042092	Process	Type 2 immune response	TAS	11244051
GO:0042100	Process	B cell proliferation	NAS	8228801
GO:0042130	Process	Negative regulation of T cell proliferation	NAS	8499633, 14971032
GO:0042493	Process	Response to drug	IEA
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042832	Process	Defense response to protozoan	IEA
GO:0043032	Process	Positive regulation of macrophage activation	IEA
GO:0043066	Process	Negative regulation of apoptotic process	NAS	8312229
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IEA
GO:0045191	Process	Regulation of isotype switching	NAS	8228801
GO:0045347	Process	Negative regulation of MHC class II biosynthetic process	IDA	1940799
GO:0045347	Process	Negative regulation of MHC class II biosynthetic process	TAS	11244051
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IEA
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IDA	7749983, 16606666
GO:0045893	Process	Positive regulation of transcription, DNA-templated	IMP	17875732
GO:0045930	Process	Negative regulation of mitotic cell cycle	ISS
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IDA	16982608
GO:0046983	Function	Protein dimerization activity	IDA	16982608
GO:0050728	Process	Negative regulation of inflammatory response	IDA	10443688
GO:0050728	Process	Negative regulation of inflammatory response	NAS	21857966
GO:0050807	Process	Regulation of synapse organization	IEA
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	IDA	18383040
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	7749983
GO:0051384	Process	Response to glucocorticoid	IDA	10443688
GO:0060302	Process	Negative regulation of cytokine activity	IMP	9847016
GO:0060670	Process	Branching involved in labyrinthine layer morphogenesis	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	NAS	14971032
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:0071650	Process	Negative regulation of chemokine (C-C motif) ligand 5 production	TAS	19262501
GO:0072577	Process	Endothelial cell apoptotic process	ISS
GO:0097421	Process	Liver regeneration	IEA
GO:1900100	Process	Positive regulation of plasma cell differentiation	IGI	22962438
GO:1902895	Process	Positive regulation of pri-miRNA transcription by RNA polymerase II	IEA
GO:1903034	Process	Regulation of response to wounding	ISS
GO:1903208	Process	Negative regulation of hydrogen peroxide-induced neuron death	ISS
GO:1903659	Process	Regulation of complement-dependent cytotoxicity	IMP	16034134
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1904057	Process	Negative regulation of sensory perception of pain	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	ISS
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	ISS
GO:2000273	Process	Positive regulation of signaling receptor activity	IDA	10443688
GO:2000352	Process	Negative regulation of endothelial cell apoptotic process	IMP	16034134

MIM	HGNC	e!Ensembl
124092	5962	ENSG00000136634

Protein

UniProt ID

P22301

Protein name

Interleukin-10 (IL-10) (Cytokine synthesis inhibitory factor) (CSIF)

Protein function

Major immune regulatory cytokine that acts on many cells of the immune system where it has profound anti-inflammatory functions, limiting excessive tissue disruption caused by inflammation. Mechanistically, IL10 binds to its heterotetrameric rec

PDB

1ILK , 1INR , 1J7V , 1LK3 , 1Y6K , 2H24 , 2ILK , 6X93 , 8SVE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00726	IL10	5 → 174	Interleukin 10	Domain

Tissue specificity

TISSUE SPECIFICITY: Produced by a variety of cell lines, including T-cells, macrophages, mast cells and other cell types. {ECO:0000269|PubMed:1940799, ECO:0000269|PubMed:7512027}.

Sequence

MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQ
LDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLR
LRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN

Sequence length

178

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor FoxO signaling pathway Efferocytosis C-type lectin receptor signaling pathway JAK-STAT signaling pathway T cell receptor signaling pathway Intestinal immune network for IgA production Pertussis Yersinia infection Leishmaniasis Chagas disease African trypanosomiasis Malaria Toxoplasmosis Amoebiasis Staphylococcus aureus infection Tuberculosis Asthma Autoimmune thyroid disease Inflammatory bowel disease Systemic lupus erythematosus Allograft rejection		Interleukin-10 signaling Interleukin-4 and Interleukin-13 signaling Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation CD163 mediating an anti-inflammatory response FCGR3A-mediated IL10 synthesis

Show/Hide Causal Diseases (23)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470
Autism	Autistic Disorder	rs121964908, rs62643608, rs181327458, rs797046134, rs869312704, rs1555013332, rs876657679, rs1057518999, rs1057518658, rs771827120, rs1555187899, rs773080572, rs753871454, rs1684130791, rs1684180699 View all (8 more)	16360218
Behcet syndrome	Behcet Syndrome, Beh�et disease	rs886040969, rs886039866, rs746055479, rs752615209, rs774164456, rs751454741	20622879, 20622878, 23291587, 26015771
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	29582634
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29582634
Cataract	Cataract	rs118203965, rs118203966, rs104893685, rs121908938, rs104894175, rs121909048, rs28937573, rs121909049, rs121909050, rs74315488, rs80358200, rs80358203, rs121434643, rs56141211, rs132630322 View all (150 more)
Dermatitis	Dermatitis, Atopic, Dermatitis, Occupational, Dermatitis, Allergic Contact	rs61816761, rs150597413, rs138726443, rs201356558, rs149484917, rs372754256, rs747301529, rs567795279, rs745915174	18249437, 29477354, 15347381
Developmental regression	Developmental regression	rs1224421127
Diabetes mellitus	Diabetes Mellitus, Insulin-Dependent, Diabetes Mellitus, Ketosis-Prone, Diabetes Mellitus, Sudden-Onset	rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237 View all (293 more)	19430480, 21980299
Glomerulonephritis	Glomerulonephritis	rs778043831	10910440
Inflammatory bowel disease	Inflammatory Bowel Diseases	rs137853579, rs137853580, rs121909601, rs149491038, rs368287711, rs387907326, rs587777338, rs758439420, rs1329427406, rs1264862631, rs1192830343, rs1373354533, rs1419560997, rs1591263883, rs1989014468	27783946, 23291587, 28411859, 26192919
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	20471133
Lung cancer	Malignant neoplasm of lung	rs121913530, rs121913529, rs878855122, rs1057519784, rs770315135	14587096
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	29582634
Migraine	Migraine Disorders	rs794727411
Multiple sclerosis	Multiple Sclerosis, Multiple Sclerosis, Acute Fulminating	rs104895219, rs483353022, rs483353023, rs483353028, rs483353029, rs483353024, rs483353030, rs3207617, rs483353031, rs483353032, rs483353033, rs483353034, rs483353035, rs483353036, rs483353039 View all (4 more)	23517930
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17999153, 16284379, 18174250
Psoriasis	Psoriasis	rs281875215, rs587777763, rs281875213, rs281875212	26974007
Renal insufficiency	Renal Insufficiency	rs1596536873
Rheumatoid arthritis	Rheumatoid Arthritis	rs587776843	22450443
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	23951054, 21216474, 24603720, 21658228
Systemic lupus erythematosus	Systemic lupus erythematosus	rs72556554, rs1575496354, rs1307379746, rs758750492, rs1575497576
Vasculitis	Vasculitis	rs376785840, rs587777240, rs200930463, rs587777241, rs77563738, rs202134424, rs148936893, rs587777242, rs775440641, rs770689762, rs45511697, rs139750129, rs756881285, rs747774101, rs1568966771 View all (6 more)

Show/Hide Unknown Diseases (9)

Disease term	Disease name	References	Source
Unknown
Appendicitis	Appendicitis, Ruptured Appendicitis	16367942	ClinVar
Crohn disease	Crohn Disease, Regional enteritis	26974007, 21102463	ClinVar
Endometriosis	Endometriosis	30579999	ClinVar
Myocardial infarction	Myocardial Infarction	16310260, 15883752	ClinVar
Pancreatitis	Pancreatitis		ClinVar
Diabetes	Diabetes		GWAS
Inflammatory Bowel Disease	Inflammatory Bowel Disease		GWAS
Ulcerative colitis	Ulcerative colitis		GWAS
Crohn Disease	Crohn Disease		GWAS

Show/Hide Text Mining Associations (1016)

Disease Name	Relationship Type	References
Associations from Text Mining
Abortion Habitual	Associate	24260517, 24975966, 29017513
Abortion Habitual	Inhibit	26345847
Abortion Missed	Associate	28851386
Abortion Spontaneous	Associate	17482605, 26084897
Abortion Spontaneous	Inhibit	21977049
Acanthosis Nigricans	Inhibit	11348460
Achondroplasia and Swiss type agammaglobulinemia	Associate	12823285
Acne Vulgaris	Associate	38115273
Acquired Immunodeficiency Syndrome	Associate	11121048, 1325212, 18391751, 20299965, 20378550, 32532356, 36003311, 7780129, 8450057
Acrocephalosyndactylia	Inhibit	24385687
Actinic cheilitis	Stimulate	25060152
Acute Chest Syndrome	Associate	26686970
Acute Coronary Syndrome	Associate	15547296, 17174184, 17690160, 25740578, 26600159
Acute Coronary Syndrome	Inhibit	28407320
Acute Coronary Syndrome	Stimulate	39399429
Acute Kidney Injury	Associate	23607333, 27788614, 32273692, 34090357, 35941899
Acute Lung Injury	Associate	22742663
Acute On Chronic Liver Failure	Associate	17177978, 36505417
Acute On Chronic Liver Failure	Stimulate	33717119, 34774066
Addison Disease	Associate	33365026
Adenocarcinoma	Associate	16133109, 16343245, 32298379, 32509861, 36790524
Adenocarcinoma of Lung	Associate	31909418, 38011277
Adenoma	Associate	21160427
Adenomatous Polyposis Coli	Associate	24073274
Adenomyosis	Associate	18439592, 30687738, 32933042
Adenosine Triphosphatase Deficiency Anemia Due To	Associate	33437900
Aggressive Periodontitis	Associate	20447254, 28099578, 28662328
AIDS Associated Nephropathy	Associate	24081683
Airway Obstruction	Associate	29580813
Alcohol Related Disorders	Associate	39848112
Alcoholism	Associate	21176217
Allergic Fungal Sinusitis	Associate	29417576, 33629532, 36780897
Alopecia Areata	Associate	7930677
alpha 1 Antitrypsin Deficiency	Associate	17690329
Altitude Sickness	Inhibit	33393628
Alveolar echinococcosis	Associate	9459621
Alzheimer Disease	Associate	15212825, 16185274, 19698145, 21368376, 23736221, 24359497, 26402514, 26402623, 26626881, 29070909, 29201645, 30336198, 32634865, 38167125, 39266981, 39880323, 40121165 View all (2 more)
Alzheimer Disease	Inhibit	31455413
Amaurosis Fugax	Associate	18307518
Amyloidosis Hereditary Transthyretin Related	Associate	31253122
Amyotrophic Lateral Sclerosis	Associate	32123048
Amyotrophic lateral sclerosis 1	Associate	19013651
Anal Gland Neoplasms	Associate	24074435, 34032699
Anaphylaxis	Associate	30189430
Androgen Insensitivity Syndrome	Stimulate	25860946
Androgen Insensitivity Syndrome	Associate	28373650
Androgen Insensitivity Syndrome	Inhibit	31598989
Anemia	Associate	38022547
Anemia Aplastic	Associate	14675414, 28459238, 32761514
Anemia Hemolytic Autoimmune	Associate	30784322
Anemia Sickle Cell	Associate	20130127, 21953592, 23720018, 26686970, 27026283, 32411797
Anemia Sickle Cell	Inhibit	26135971
Aneurysm	Associate	24707114
Angina Stable	Associate	17174184, 28407320
Angina Unstable	Stimulate	28474494
Anodontia	Stimulate	28578351
Anodontia	Associate	36675305
Anthropophobia	Associate	35029197
Anti N Methyl D Aspartate Receptor Encephalitis	Associate	32771066, 34220828
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	15762890, 22880107, 25376552
Antiphospholipid Syndrome	Associate	30687319
Aortic Aneurysm	Stimulate	28434701
Aortic Aneurysm Abdominal	Associate	12756345, 15288631, 16899122, 17321344, 17903648, 25198969, 25854712, 26782404, 32138469
Aortic Aneurysm Abdominal	Inhibit	31885770
Aortic Aneurysm Thoracic	Associate	24707114
Aortic Arch Syndromes	Associate	17133531
Apnea	Associate	26982450
Arterial Occlusive Diseases	Inhibit	20130127
Arthritis	Associate	10366102, 19565513, 22550014
Arthritis Gouty	Associate	36994890
Arthritis Infectious	Associate	19930904, 33613540, 7722463
Arthritis Juvenile	Associate	10366102, 12847694, 16959027, 17469159, 17530721, 23092393, 23094074, 23121667, 26934060, 28257625, 31958219, 9105428
Arthritis Juvenile	Stimulate	19565513
Arthritis Juvenile	Inhibit	28012239
Arthritis Psoriatic	Associate	10857783, 11180010, 11564829, 16507115, 16947381, 37979213
Arthritis Psoriatic	Inhibit	11348460
Arthritis Reactive	Associate	10524675, 11352256
Arthritis Rheumatoid	Associate	10343540, 10366101, 10447928, 10857783, 11056676, 11879539, 12384915, 12562402, 12571841, 12782719, 12847677, 15497451, 15535835, 15743469, 15761492 View all (27 more)
Arthritis Rheumatoid	Inhibit	10728756, 29096690, 30915732
Arthritis Rheumatoid	Stimulate	15140777, 15361394, 23091349, 26711868, 28183329, 34301999
Ascites	Associate	16412052, 16617566, 20430716, 20860602, 23784932, 26638169, 28327095, 28410380, 31039761, 34359872, 34887625
Asthma	Associate	10704078, 12938145, 14748015, 16341266, 19852851, 20371397, 20926789, 21179211, 21457191, 23273955, 23527710, 23683514, 23984295, 24428972, 24450586 View all (14 more)
Asthma	Stimulate	17349011, 22363778, 24641294
Asthma	Inhibit	18780949
Astrocytoma	Associate	7856743
Ataxia Telangiectasia	Inhibit	29899423
Atherosclerosis	Inhibit	12857749, 23811604, 31430072
Atherosclerosis	Associate	15547296, 17438520, 21358010, 24707114, 30080219, 35052452, 37339167, 8621803
Atrial Fibrillation	Associate	32345003
Atrophy	Stimulate	20150436
Attention Deficit Disorder with Hyperactivity	Associate	26473365, 38066446
Autism Spectrum Disorder	Associate	22226452, 29178897, 31554204, 31616420, 38288647
Autism Spectrum Disorder	Inhibit	30430410
Autistic Disorder	Associate	23353117
Autoimmune Diseases	Associate	11964134, 15497451, 16380445, 18057536, 20227772, 22425265, 22882653, 23094074, 23189166, 23679256, 24130510, 24470136, 25187566, 25604082, 25966091 View all (8 more)
Autoimmune enteropathy	Stimulate	15591503
Autoimmune Lymphoproliferative Syndrome	Stimulate	11342444
Autoimmune Lymphoproliferative Syndrome	Associate	12406097, 19176318, 20360470, 22857792, 25174872, 26113417
Axial Spondyloarthritis	Associate	26178906, 36995469
Bacteremia	Associate	19144812, 33256638, 36566774, 39966757
Bacterial Infections	Associate	12414752, 34925324, 35197229, 36630812
Bacterial Infections	Stimulate	14987733, 25526183
Barrett Esophagus	Associate	11889061
Barrett Esophagus	Stimulate	33941087
Basal Ganglia Diseases	Associate	31415412, 36860843
Behcet Syndrome	Associate	20622878, 22378604, 24286189, 24749687, 24984193, 25941808, 26015771, 29017598, 29895319, 33393726, 35455984, 37264476
Berylliosis	Associate	12449171
beta Thalassemia	Associate	10519993, 32581238
Bipolar Disorder	Stimulate	29803226, 37058046
Bipolar Disorder	Associate	35136035, 38484669
Blast Injuries	Inhibit	36508265
Blister	Associate	26293297
Blood Coagulation Disorders	Inhibit	9695978
Bone Marrow Diseases	Associate	36567775
Boutonneuse Fever	Associate	19386798
Brain Death	Stimulate	17430397
Brain Neoplasms	Associate	31436254
Breast Neoplasms	Associate	15931634, 16030322, 16672066, 16710719, 17261184, 18566447, 18651178, 18685848, 20204402, 20553628, 20646924, 22353218, 24172169, 24411993, 24502445 View all (21 more)
Breast Neoplasms	Stimulate	31552680
Breast Neoplasms	Inhibit	39518934
Bronchiectasis	Inhibit	31503552
Bronchiolitis	Associate	21910858, 26473365, 27695990
Bronchiolitis	Stimulate	32628310, 36561744
Bronchiolitis Obliterans Syndrome	Associate	22733028, 23685278
Bronchopulmonary Dysplasia	Inhibit	19581835
Bronchopulmonary Dysplasia	Associate	25409741
Burkitt Lymphoma	Associate	11118209, 11162833, 1325212, 17237610, 21791113, 23029361, 25071000, 29033373, 29078819
Burns	Associate	20863526, 21760883, 35363228
Cachexia	Associate	19244371
Calcinosis Cutis	Associate	25961062
Calcinosis Cutis	Stimulate	39227608
Cancer Pain	Associate	33000216, 34670213
Candidiasis	Associate	12101077
Cap Myopathy	Associate	17094460
Carcinogenesis	Associate	12535204, 22235320, 22594912, 23359190, 25071000, 25744234, 28675120, 29935877, 32799717, 34581419, 37530244
Carcinogenesis	Inhibit	19823053
Carcinoma Basal Cell	Associate	17508019, 21760883, 21980389, 8450029
Carcinoma Ductal	Associate	27903846
Carcinoma Giant Cell	Associate	21196886
Carcinoma Hepatocellular	Associate	18479293, 19826049, 25027084, 26400525, 26783377, 27136203, 27853178, 29568203, 31448426, 31724091, 32218692, 32258134, 32387446, 32724815, 33633112, 34710996, 35637248 View all (2 more)
Carcinoma Hepatocellular	Inhibit	19126646
Carcinoma Intraductal Noninfiltrating	Stimulate	18685848
Carcinoma Non Small Cell Lung	Associate	10997808, 17537769, 21507199, 21595995, 21597388, 23566546, 23658645, 30278439, 31670094, 35222434, 38054663, 38231411
Carcinoma Non Small Cell Lung	Stimulate	19505916
Carcinoma Ovarian Epithelial	Associate	20860602, 30485902, 9649178
Carcinoma Ovarian Epithelial	Stimulate	21917055
Carcinoma Pancreatic Ductal	Associate	33299656
Carcinoma Renal Cell	Stimulate	10408703, 10944605
Carcinoma Renal Cell	Associate	17346426, 18344594, 20208540, 23434518, 26715281, 31781309, 32012488, 32469992, 38148073, 7656270
Carcinoma Small Cell	Associate	16276011
Carcinoma Squamous Cell	Associate	12535204, 16133109, 16343245, 19387481, 21760883, 23430974
Cardiomyopathies	Associate	34458163, 36298704
Cardiomyopathy Dilated	Associate	10850534, 18654018
Cardiomyopathy Dilated	Stimulate	26339378
Cardiomyopathy Dilated	Inhibit	29566367
Cardiomyopathy Hypertrophic	Associate	22447464
Cardiomyopathy Hypertrophic Familial	Stimulate	15606623
Cardiovascular Diseases	Associate	12164877, 20662694, 28474494, 31871930, 39199367
Cardiovascular Diseases	Stimulate	28474494
Carotid Stenosis	Associate	27001002
Cartilage Diseases	Inhibit	22503813
Cataract	Associate	39959181
Celiac Disease	Associate	16540751, 23844808, 33054308, 34449925, 35354862, 37047806, 38040898
Cell Transformation Neoplastic	Associate	32418990, 39273558
Cerebral Hemorrhage	Associate	31646585, 36439158
Cerebral Hemorrhage	Stimulate	38167007
Cerebral Infarction	Associate	24040186, 24394869, 26722562, 26722564, 27051029, 30080219
Cerebral Infarction	Stimulate	36066144
Cerebrospinal Fluid Rhinorrhea	Associate	11985531
Cerebrovascular Disorders	Associate	24260517
Chagas Disease	Associate	24603474, 24608170, 27115869, 34458163
Charcot Marie Tooth Disease Recessive Intermediate A	Associate	20484443
Chemical and Drug Induced Liver Injury	Associate	32387446, 36608595
Child Behavior Disorders	Associate	29178897
Chlamydial Pneumonia	Associate	28440293
Cholangiocarcinoma	Associate	22290731, 31976810
Cholangitis Sclerosing	Associate	25953611, 29720090
Cholestasis	Associate	11910576
Cholestasis progressive familial intrahepatic 1	Associate	29104077
Cholesteatoma	Associate	36837507
Chorioamnionitis	Associate	33976432
Choroidal Neovascularization	Stimulate	27558944
Chronic Disease	Inhibit	12857749
Chronic Disease	Associate	18490762, 27977792, 28662328, 30700717, 31586435
Chronic Disease	Stimulate	22496237
Chronic Pain	Associate	16871547, 39231552
Chronic Periodontitis	Associate	21815905, 24670840, 25129246, 25530681, 26211001, 27737359, 28410151, 28662328, 29489938, 29899423
Chronic Periodontitis	Inhibit	31944625
Churg Strauss Syndrome	Associate	18512809, 20729468
Cicatrix	Associate	8809130
Ciliary Discoordination Due To Random Ciliary Orientation	Associate	32532356
Clear cell metastatic renal cell carcinoma	Associate	28812429
Cleft Lip	Associate	11781245, 31443525
Cleft Lip	Stimulate	25139022
Cleft Palate	Associate	22174866, 25129246
Cleft Palate	Stimulate	30688042
Cleft Palate	Inhibit	31944625
Coccidioidomycosis	Associate	12204956
Cognition Disorders	Associate	20083555, 28705468, 30256904, 32634865, 35950445
Cognitive Dysfunction	Associate	29201645, 30256904
Coinfection	Associate	33013921
Colitis	Associate	11772962, 19890111
Colitis Ulcerative	Stimulate	10719056, 12974765, 30369485, 31584460, 31798282, 31842582, 36169258, 7664489
Colitis Ulcerative	Associate	16566641, 18190460, 18442197, 19309553, 20509889, 21304977, 22543157, 22550014, 24379584, 24971461, 25076849, 26090671, 27558476, 28453768, 29765931 View all (4 more)
Colonic Neoplasms	Stimulate	28812429
Colorectal Neoplasms	Associate	11282551, 15188028, 19760027, 22594912, 24015034, 24194923, 25076849, 25209180, 26509874, 27619682, 29368606, 30973070, 32358386, 32390702, 33294886 View all (4 more)
Colorectal Neoplasms	Inhibit	19760027, 27494857
Colorectal Neoplasms	Stimulate	33294886, 39227608
Coma	Associate	23614351
Combined Saposin Deficiency	Associate	16038043
Common Variable Immunodeficiency	Associate	18254984, 20629103, 29345621, 31827477, 33190167, 35589883, 9042433, 9486401
Communicable Diseases	Associate	20732847, 25613737, 27819740, 32532356
Communication Disorders	Associate	12554901, 16440070, 23258791, 24379064, 27368016, 29847542, 35052452
Communication Disorders	Inhibit	17052299
Congenital disorder of glycosylation type 1A	Associate	35711443
Conjunctivitis Allergic	Associate	30818819
Constriction Pathologic	Inhibit	32802883
Coronary Aneurysm	Associate	24659220, 26097597
Coronary Artery Disease	Stimulate	11882051, 33731531
Coronary Artery Disease	Associate	17174184, 20339193, 20519163, 21889313, 24699044, 26505399, 27173291, 27813553, 28596642, 30392493, 31411246, 33029103, 37824465
Coronary Artery Disease Autosomal Dominant 1	Associate	20519163
Coronary Disease	Associate	17690160, 27997991, 34861059
Coronary Disease	Stimulate	28390432
Coronary Restenosis	Associate	25253465
Coronavirus Infections	Stimulate	28118607
Cough	Associate	22927709
COVID 19	Stimulate	32217834, 32866033, 34831410, 35146763, 35676607, 36925435, 37515295, 37674148
COVID 19	Associate	32307550, 32501293, 32532356, 32805728, 32920092, 32950268, 33041191, 33052054, 33154753, 33239683, 33317616, 33552062, 33692788, 33751722, 33767713 View all (41 more)
Craniopharyngioma	Associate	28859336
Critical Illness	Associate	15288631, 33041191, 9218830
Crohn Disease	Associate	10719056, 11772962, 12231473, 14678275, 15937090, 16461743, 16489646, 19237638, 19673019, 20509889, 21304977, 23598818, 24074435, 24718601, 26090671 View all (9 more)
Crohn Disease	Inhibit	12857749, 35665507
Crohn Disease	Stimulate	34383142, 38201264, 7664489
Cross Infection	Stimulate	27015534
Cryopyrin Associated Periodic Syndromes	Associate	24773462
Cystic Disease Of Lung	Associate	24853301
Cystic Fibrosis	Associate	10515411, 10844532, 12507912, 15373916, 15463896, 18026571, 18093884, 25803862
Cystic Fibrosis	Stimulate	24098711
Cystitis Interstitial	Associate	30973927
Cysts	Associate	21755330, 27491076
Cytokine Release Syndrome	Associate	12351400, 26921773, 34670484, 36105799, 37979213, 39328408
Cytokine Release Syndrome	Inhibit	25875601, 30380327
Cytokine Release Syndrome	Stimulate	39966958
Cytomegalovirus Infections	Associate	28338007, 32532356, 33861738
Cytomegalovirus Infections	Stimulate	32749463, 33013921
Death	Associate	12554901, 14657427, 17690160, 17698689, 18235144, 20457266, 20863526, 23430974, 23607333, 24015034, 26768248, 32532356, 33767713, 33861738, 39182143
Death	Stimulate	37844090
Death	Inhibit	8040267
Delayed Graft Function	Associate	24959002
Deltaretrovirus Infections	Associate	30466392
Dementia	Associate	28705468
Demyelinating Diseases	Associate	29518260
Dengue	Associate	18272578, 26421267
Dependent Personality Disorder	Associate	38497670
Depression Postpartum	Associate	34856750
Depressive Disorder	Associate	14632756, 23149083, 31205078
Depressive Disorder	Stimulate	24143878, 37058046
Depressive Disorder Major	Associate	17610667, 37058046
Depressive Disorder Major	Stimulate	29856741
Dermatitis Atopic	Associate	16185274, 17960185, 20232770, 22533231, 22968402, 26124183, 28821884, 30286163, 30515983, 33390552, 33975024, 38302650
Dermatitis Atopic	Inhibit	22427475
Dermatitis Atopic 1	Associate	12938145, 20232770
Dermatitis Atopic 3	Associate	12938145, 20232770
Dermatitis Herpetiformis	Inhibit	25465638
Dermatitis Toxicodendron	Associate	7923918
Dermatomyositis	Associate	34997119, 37985458
Developmental Dysplasia of the Hip	Associate	25578529
Diabetes Gestational	Associate	20536548, 28846666
Diabetes Gestational	Inhibit	30539027, 36203592
Diabetes Gestational	Stimulate	36499008
Diabetes Mellitus	Associate	11896938, 26268591, 26823869, 29513874, 30256013, 33114431, 34517005
Diabetes Mellitus	Stimulate	22385239, 32265833
Diabetes Mellitus	Inhibit	27001002, 30539027
Diabetes Mellitus Type 1	Associate	11092695, 18163472, 19127455, 19430480, 20176734, 23494449, 24523574, 24773525, 31558544, 31849037, 33365026, 35404688, 35754999, 36766809, 39464889
Diabetes Mellitus Type 1	Stimulate	26636339
Diabetes Mellitus Type 1	Inhibit	39273664
Diabetes Mellitus Type 2	Stimulate	21289232, 36313784
Diabetes Mellitus Type 2	Associate	23768819, 24758873, 26064986, 27706650, 28225860, 29227971, 29947343, 30256013, 33858419, 34944529, 37626843, 39202464, 40080435
Diabetes Mellitus Type 2	Inhibit	29752628, 34079246
Diabetic Foot	Associate	33096729
Diabetic Nephropathies	Associate	26823869, 28060893, 29227971, 30345559
Diabetic Retinopathy	Stimulate	26268591
Diabetic Retinopathy	Inhibit	27525838, 36766809
Diabetic Retinopathy	Associate	29227971, 30890581, 32117292
DiGeorge Syndrome	Associate	23353117
Disease	Associate	10219772, 16489646, 18435801, 27302973, 31809599, 32298379
Disease	Stimulate	15591503, 17362267
Disseminated Intravascular Coagulation	Inhibit	9695978
Dizziness	Associate	33840589
Down Syndrome	Associate	25222269, 30186038
Down Syndrome	Stimulate	33206953
Drug Fever	Inhibit	16384931
Drug Hypersensitivity	Associate	10651989, 17349011, 19657353, 22882653, 23265747, 23273955, 23521868, 24819158, 25744234, 26124183, 28250252, 30306557, 30818819, 31205078, 35456412, 37876509, 38497670 View all (2 more)
Drug Hypersensitivity	Stimulate	18782262
Drug Related Side Effects and Adverse Reactions	Associate	10691913, 12738388, 15819704, 22040089, 27136203, 39199367
Drug Related Side Effects and Adverse Reactions	Stimulate	10775611
Dry Eye Syndromes	Associate	27247515, 37876509
Dyskinesia Drug Induced	Associate	23951054
Dyslipidemias	Inhibit	22912426
Dyslipidemias	Associate	23073467, 35274685
Dyslipidemias	Stimulate	28316372
Dyspnea	Associate	33840589
Ectodermal Dysplasia	Associate	24962617, 26112140
Edema	Associate	34439789
Elejalde Disease	Associate	35455984
Embolism Air	Associate	24945146
Emphysema	Associate	24805101
Encephalitis	Associate	28935853, 31678190
Encephalitis Japanese	Stimulate	40536377
Encephalitis Tick Borne	Associate	29247709
Encephalocele	Associate	21863566, 27807886
Encephalomyelitis Autoimmune Experimental	Associate	12101075
Endocarditis	Associate	11254592, 26225421
Endometrial Neoplasms	Inhibit	23051953
Endometrial Neoplasms	Stimulate	35403529
Endometrial Neoplasms	Associate	36263059, 36675305
Endometriosis	Associate	16359969, 18684450, 18687423, 18930197, 28300844, 29308924, 29771400, 32311852, 35403529, 36263059, 36869723
Endometriosis	Stimulate	34360900
Endometritis	Associate	30606202
Enterocolitis	Associate	18259614, 20011655, 34032699
Enterocolitis	Stimulate	33891982
Enterocolitis Necrotizing	Stimulate	23472217
Enterocolitis Necrotizing	Associate	24732104
Eosinophilia	Associate	29580813
Eosinophilic Esophagitis	Associate	29790577, 38013163
Epidermolysis Bullosa Simplex	Stimulate	34536484
Epilepsies Partial	Associate	39259090
Epilepsy Familial Mesial Temporal Lobe	Associate	22935090
Epileptic Syndromes	Associate	22891927
Epstein Barr Virus Infections	Associate	16332968, 17979488, 18056366, 18163983, 26222684, 8040267, 8639912
Epstein Barr Virus Infections	Stimulate	25041527, 28883511
Erysipelas	Associate	28512644
Erythema Nodosum	Associate	10564558, 31781675, 32034084
Esophageal Neoplasms	Associate	23886125, 26464722, 39896813
Esophageal Squamous Cell Carcinoma	Associate	11889061, 15682481, 23886125, 31276257, 32744314, 34799871, 36437782
Evans Syndrome	Associate	30784322
Exanthema	Associate	23566546
Exfoliation Syndrome	Associate	32050932, 33914756
Eye Infections Fungal	Associate	7860769
Fabry Disease	Associate	17353161, 31221509, 38304433
Fallopian Tube Diseases	Associate	12562392
Fallopian Tube Diseases	Inhibit	34414130
Familial cylindromatosis	Associate	32100077
Familial Mediterranean Fever	Inhibit	15544632
Fatigue	Associate	23149083, 27664835
Fatigue Syndrome Chronic	Associate	19647494, 30929860, 9201656
Fatigue Syndrome Chronic	Stimulate	21619669, 9874656
Fatigue Syndrome Chronic	Inhibit	25834308
Fatty Liver	Associate	16425360, 19401628
Fever	Stimulate	19561472, 25256892, 38139402
Fever	Associate	28935853, 30696839, 35022648, 35371275
Fibrocartilaginous embolism	Associate	33378011, 37102649
Fibrosis	Associate	10590064, 16940525, 22824292, 25027084, 25450336, 25797191, 28842322, 33924242, 34373467, 36674897, 39315805
Fibrosis	Stimulate	20150436, 23446058
Fibrosis	Inhibit	33125400
Focal Cortical Dysplasia	Inhibit	29162878
Folliculitis	Associate	34032699
Food Hypersensitivity	Associate	20825428, 22299310, 23265747, 24532064, 29178897, 38497670
Fragile X Tremor Ataxia Syndrome	Associate	23062006, 33285358
Frontotemporal Dementia	Associate	11407990
Frontotemporal Lobar Degeneration	Associate	31559531
Gastritis	Inhibit	26088449
Gastritis	Associate	26088449, 34471638
Gastritis	Stimulate	27196487
Gastritis Atrophic	Associate	30205739
Gastrointestinal Neoplasms	Associate	15682481
GATA2 Deficiency	Associate	11286472, 16332968
general anxiety disorder	Associate	35866837
Giant Cell Arteritis	Associate	17133531, 37703805
Gingivitis	Associate	34234776
Gingivitis	Inhibit	35665507
Glaucoma	Stimulate	22355254
Glaucoma Open Angle	Associate	26820987, 32050932
Glioblastoma	Inhibit	23663500
Glioblastoma	Associate	23663500, 31791385, 32457755, 35177622, 36230961
Glioma	Associate	20406895, 22752645, 23525950, 23613317, 25342742, 26516307, 27287871, 27811370, 31152305, 31436254, 7856743
Glioma	Stimulate	28107450
Glomerulonephritis	Associate	15200436, 16361810
Glomerulonephritis IGA	Associate	15200436, 16361810, 28359052
Glomerulonephritis IGA	Inhibit	24219615
Glomerulonephritis Membranous	Stimulate	15954921
Glomerulosclerosis Focal Segmental	Associate	15200436, 16361810
Glucosephosphate Dehydrogenase Deficiency	Associate	32630408
Graft vs Host Disease	Inhibit	10572111, 30142416, 35114361
Graft vs Host Disease	Associate	11520812, 12239181, 12472598, 14657427, 15931634, 16109775, 18234053, 19295315, 19409109, 20446793, 20457266, 21358669, 34152493, 34404616, 36056390, 36555525, 9808588 View all (2 more)
Gram Negative Bacterial Infections	Associate	32996896
Gram Positive Bacterial Infections	Associate	26932518, 32996896
Granuloma	Associate	16714557, 32566036
Granuloma Giant Cell	Associate	21196886
Granulomatosis with Polyangiitis	Associate	15708894, 25939343
Granulomatous Disease Chronic	Associate	9459621
Graves Disease	Associate	23189166, 26016954, 33943012
Graves Disease	Inhibit	31790305
Guillain Barre Syndrome	Associate	33751722, 37955408
Hashimoto Disease	Associate	21876975, 26821743, 31790305, 33578562, 33943012
Hashimoto Disease	Stimulate	32348468
Head and Neck Neoplasms	Associate	26747525, 30762321
Hearing Loss	Stimulate	36593740
Heart Diseases	Associate	24091885, 30356307, 31632400, 36255356
Heart Failure	Associate	10614840, 18353715, 25984539, 31124999, 31632400, 35409075, 35775773
Heart Failure	Inhibit	34744513
Heart Valve Diseases	Associate	26039365
Helicobacter Infections	Stimulate	10655986, 12738388, 23299619
Helicobacter Infections	Associate	15247172, 22235320, 25888319
HELLP Syndrome	Associate	24612145
Hematologic Diseases	Associate	24205307
Hematologic Neoplasms	Inhibit	24256874
Hematologic Neoplasms	Associate	31983108
Hematoma	Associate	28282868
Hemolytic Uremic Syndrome	Stimulate	31924826
Hemolytic Uremic Syndrome	Associate	40149873
Hemophilia A	Associate	16380445, 21362111, 31194850
Hemorrhage	Associate	31217347
Hepatitis Autoimmune	Associate	25953611
Hepatitis Autoimmune	Inhibit	31422415
Hepatitis B	Associate	11737614, 23872054, 25027084, 32387446, 32532356, 33506937
Hepatitis B Chronic	Associate	18479293, 23395388, 26617910, 26909998, 32387446
Hepatitis C	Associate	16940525, 17634507, 21467695, 22535775, 24081683, 25797191, 32532356, 33125400, 34710996
Hepatitis C	Stimulate	26783377, 31952232
Hepatitis C Chronic	Associate	12046093, 15057302, 16425360, 16940525, 17634507, 24081683, 25613737, 29247709, 32532356, 32994477
Hepatitis E	Associate	29285885
Hereditary Breast and Ovarian Cancer Syndrome	Associate	20646924, 26112140, 32393308
Hereditary leiomyomatosis and renal cell cancer	Associate	11815953, 17979488, 8443970, 9680372
Hernia Inguinal	Associate	26826613
Herpes Genitalis	Associate	12823283
Herpes Labialis	Associate	32735468
Herpes Zoster	Associate	34322810
Hidradenitis Suppurativa	Associate	38011564
Hippocampal Sclerosis	Inhibit	29162878
Hirschsprung Disease	Associate	36248794
Histiocytosis Langerhans Cell	Associate	10590064
HIV Infections	Associate	10193420, 10403920, 10973452, 11121048, 12468426, 16920714, 17511776, 18490780, 18573939, 19005268, 19365081, 19630502, 20208540, 20299965, 20416280 View all (25 more)
HIV Infections	Stimulate	22496237, 23434518, 26776123, 27534685, 28143443, 34446704, 8113410, 8606100, 9353145
HIV Seropositivity	Associate	11851889, 20460119
HIV Seropositivity	Inhibit	23601964, 33459349
Hodgkin Disease	Associate	17496310, 17979488, 21385932, 23299779, 24008079, 33684151, 8639912, 9680372
Hodgkin Disease	Stimulate	25041527
HTLV I Infections	Associate	17634507, 19534595, 22100578, 25521499, 26546777, 31166487, 7860769
Huntington Disease	Stimulate	37674148
Hyaline Membrane Disease	Associate	8725256
Hypercholesterolemia	Associate	27121486
Hypergammaglobulinemia	Associate	9808566
Hyperglycemia	Inhibit	27001002
Hyperglycemia	Associate	27294162, 40080435
Hyperglycemic Hyperosmolar Nonketotic Coma	Associate	36517975, 37240180
Hyperinsulinism	Associate	25944984
Hypersensitivity	Associate	11511310
Hypersensitivity Immediate	Associate	20232770
Hypersensitivity Immediate	Inhibit	39201708
Hypertension	Associate	25973747, 26064986, 26198819, 28537431, 29504915
Hypertension Portal	Associate	24705150
Hypertension Pregnancy Induced	Inhibit	29846432
Hypertension Pulmonary	Associate	35186226
Hypertension Pulmonary	Stimulate	37985458
Hypertrophy	Associate	28894116, 30345559, 30425273
Hypertrophy Left Ventricular	Inhibit	33879070
Hypotension	Stimulate	22080961
Hypothermia	Stimulate	38497670
Hypothyroidism	Inhibit	31350776
Hypothyroidism	Stimulate	31560937, 39185088
Hypothyroidism Congenital Nongoitrous 2	Associate	28300844
Hypoxia	Inhibit	27558590
Hypoxia	Stimulate	34367731, 35457151
Hypoxia Brain	Inhibit	28536432
Hypoxia Ischemia Brain	Associate	28252659
Idiopathic Noncirrhotic Portal Hypertension	Associate	10896923, 21467695, 23446058
Idiopathic Noncirrhotic Portal Hypertension	Stimulate	33723292, 34887625
Idiopathic Pulmonary Fibrosis	Stimulate	12882453
Idiopathic Pulmonary Fibrosis	Associate	15303638, 15809201, 23815594, 26709222, 39896814
Idiopathic Pulmonary Fibrosis	Inhibit	21309737
IgA Deficiency	Associate	16803619, 9099927, 9649225
IgA Vasculitis	Associate	11817607
Ige Responsiveness Atopic	Associate	15497451, 17349011, 19852851
Ileal Diseases	Associate	20722024
Immune Reconstitution Inflammatory Syndrome	Stimulate	28316373, 29135655
Immune Reconstitution Inflammatory Syndrome	Associate	29538651
Immune System Diseases	Associate	16030322, 16617566, 18490780, 20722464, 24762057, 35013572, 35222434
Immunoglobulin G4 Related Disease	Associate	22824292, 25450336, 25571893, 28434701, 35568079, 36831337
Immunoglobulin G4 Related Disease	Stimulate	26311608
Immunologic Deficiency Syndromes	Associate	16920714, 18062799, 22550014, 28159873
Infarction	Stimulate	33122738
Infections	Stimulate	11162833, 22306269, 27367597, 27409177, 32418990, 35911743, 39456722
Infections	Inhibit	11179309, 31828175, 33121314, 34414130
Infections	Associate	12717692, 15596839, 15845479, 16232223, 16369000, 16714557, 19534595, 21792878, 22470519, 23273955, 23563829, 23800422, 23897063, 25157980, 25966091 View all (17 more)
Infectious Mononucleosis	Inhibit	12799212
Infectious Mononucleosis	Associate	8040267
Inferior Wall Myocardial Infarction	Inhibit	23696918
Infertility	Associate	29771400
Inflammation	Inhibit	10320650, 10691913, 10716685, 10850534, 10896923, 11737614, 11738291, 11920517, 11939722, 12101075, 12164877, 12202878, 12507912, 12625840, 12746045 View all (146 more)
Inflammation	Associate	10359806, 10400827, 10429980, 10542212, 10704147, 10712670, 11037875, 11121048, 11705931, 11710918, 11772962, 11889061, 12171950, 12477767, 12554901 View all (351 more)
Inflammation	Stimulate	36169258, 39966958
Inflammatory Bowel Disease 25 Autosomal Recessive	Associate	33849446, 37986047
Inflammatory Bowel Diseases	Associate	12625840, 15020649, 15762887, 16566641, 19673019, 20509889, 20629103, 22158873, 22543157, 22550014, 24089328, 25200001, 25314644, 26660358, 26822028 View all (24 more)
Inflammatory Breast Neoplasms	Associate	27991524, 28675120, 36202317
Influenza Human	Inhibit	21771345
Influenza Human	Associate	21966414, 22174866, 23872054, 25254368, 25367297, 32436879, 33766078
Insulin Resistance	Associate	19401628
Insulin Resistance	Inhibit	25944984
Intervertebral Disc Degeneration	Associate	27807886, 29636026, 40426248
Intervertebral disc disease	Associate	21863566, 24971599
Intestinal Diseases	Associate	16540751, 19822020
Intestinal Perforation	Associate	31931724
Intestinal Polyposis	Associate	25228656
Intracranial Aneurysm	Associate	26198819, 35711443
Intracranial Hypertension	Associate	35812382
Intrahepatic Cholestasis of Pregnancy	Associate	35643225
Intraocular Lymphoma	Associate	14984496, 24612100, 27716122, 36721307
Invasive Pneumococcal Disease Recurrent Isolated 2	Associate	29725107
Invasive Pulmonary Aspergillosis	Associate	12393638, 22731696
Iridocyclitis	Stimulate	10361227
Iridocyclitis	Associate	35178133
Irritable Bowel Syndrome	Associate	12477767, 22158028, 24206549, 24667736, 30246694, 31205078, 34115808, 37404119
Irritable Bowel Syndrome	Inhibit	31205078
Ischemic Stroke	Associate	31721299, 35441431
Job Syndrome	Associate	12694256, 21300911, 21792878
Joint Diseases	Associate	12847677
Keloid	Associate	34553702
Keratoacanthoma	Associate	10408389
Keratoconus	Associate	36051483
Keratosis Seborrheic	Associate	8450029
Kidney Diseases	Associate	17622313, 24610932, 26064986, 30345559
Kidney Failure Chronic	Associate	22617684, 7723241
Kidney Failure Chronic	Inhibit	31875015
Kidney Neoplasms	Associate	17346426
Laryngeal Neoplasms	Associate	30762321
Latent Tuberculosis	Associate	25887222
Latent Tuberculosis	Stimulate	29996789
Leiomyoma	Inhibit	34256950
Leishmaniasis	Associate	22570089, 32966326
Leishmaniasis Cutaneous	Associate	15716079, 25139022, 8112853
Leishmaniasis Diffuse Cutaneous	Associate	8443970
Leishmaniasis Visceral	Associate	12641659, 25200768, 25941808
Leprosy	Associate	19058987, 20640364, 23563829, 23966553, 24065643, 24578538, 25941808, 25992795, 31781675, 32433683, 37153623
Leprosy	Stimulate	32849660
Leprosy Lepromatous	Associate	10844525, 10903757, 19058987, 22556091, 22570089, 22851198, 23449998, 32849660, 9893041
Leprosy Lepromatous	Stimulate	25412496
Leprosy Tuberculoid	Stimulate	25412496
Leprosy Tuberculoid	Associate	38167007
Leukemia	Associate	23349302, 7540066, 8228801, 8704212, 8879210
Leukemia Acute X Linked	Associate	34299256
Leukemia Biphenotypic Acute	Associate	17709502
Leukemia Large Granular Lymphocytic	Associate	17156396, 29148541
Leukemia Lymphocytic Chronic B Cell	Associate	11133769, 16030322, 16517754, 19657365, 21398617, 22945689, 23349394, 24166938, 24470136, 27317770, 27602755, 29276179, 32227331, 35193595, 35805957, 38415531, 7530690, 8228801, 8555496 View all (4 more)
Leukemia Lymphocytic Chronic B Cell	Stimulate	23136257
Leukemia Lymphoid	Associate	38415531
Leukemia Lymphoma Adult T Cell	Stimulate	23962110, 29444188
Leukemia Lymphoma Adult T Cell	Associate	28910419, 37137914, 8704212
Leukemia Monocytic Acute	Associate	26339660
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	22271889, 24819026
Leukemia Myeloid	Associate	25409436, 33054128
Leukemia Myeloid	Inhibit	28807569, 8879210
Leukemia Myeloid Acute	Associate	23179394, 23616009, 23725154, 25730030, 26081440, 28528702, 30197353, 31350948, 31373163, 34459452, 34504191, 8805932
Leukemia Myeloid Acute	Inhibit	28084439
Leukemia Myeloid Acute	Stimulate	33083479
Leukemia Myelomonocytic Chronic	Associate	30026572, 8879210
Leukemia Plasma Cell	Associate	7727780
Leukemia Prolymphocytic T Cell	Associate	11703320, 19573080
Leukocyte Disorders	Inhibit	32862238
Leukoencephalopathies	Stimulate	36280708
Leukoencephalopathies	Associate	38054663
Leukoencephalopathy Progressive Multifocal	Associate	23092393
Leukoplakia	Associate	31890299
Leukoplakia Oral	Associate	28053372
Lichen Planus Oral	Associate	26221924, 29813046, 7738356
Light Fixation Seizure Syndrome	Associate	24206549, 33505153
Liver Cirrhosis	Associate	16718780, 20473581, 21467695, 23840511, 26617910, 26909998, 36608595, 36674897, 39315805
Liver Cirrhosis Alcoholic	Associate	10896923, 19737238, 24835349
Liver Cirrhosis Biliary	Associate	12765479, 12847677, 17158635, 20638239, 34367180
Liver Diseases	Associate	10716685, 21467695, 24409064, 25953611, 26783377, 34497613
Liver Diseases Alcoholic	Associate	10716685
Liver Failure	Associate	10716685, 28838891
Liver Failure Acute	Associate	36308662
Liver Neoplasms	Associate	26301107
Lung Diseases	Associate	20883321, 24853301, 34427644, 36255321, 39298399
Lung Diseases	Stimulate	24292748
Lung Diseases Interstitial	Associate	20404807
Lung Injury	Inhibit	34483230
Lung Neoplasms	Associate	10997808, 11549573, 16276011, 19124500, 19505916, 20112337, 23149083
Lung Neoplasms	Stimulate	21507199, 21595995, 30953795, 31552680
Lupus Erythematosus Discoid	Associate	15800006
Lupus Erythematosus Systemic	Associate	10025928, 10343522, 10447736, 10643707, 11014347, 11226290, 11238636, 11359450, 12097418, 12562402, 15800006, 16030322, 16412052, 16507146, 17082661 View all (34 more)
Lupus Erythematosus Systemic	Stimulate	10446864, 11122256, 12480667, 15498048, 20589076, 24062776, 25187566, 27814627, 29271478, 31871930, 33198645, 33882880, 39818255, 9010506
Lupus Nephritis	Associate	17324967, 21635228
Lupus Nephritis	Inhibit	30594048
Lyme Neuroborreliosis	Associate	11985531
Lymphatic Metastasis	Stimulate	17537769, 21595995, 24762057
Lymphatic Metastasis	Associate	30485902
Lymphedema	Associate	24502445
Lymphohistiocytosis Hemophagocytic	Associate	21325597, 35510179, 40262247
Lymphoma	Associate	11781245, 17237610, 17408400, 18024395, 20191326, 20207982, 20299965, 22016619, 22156547, 22323454, 22628023, 26121143, 26314692, 26464657, 26987877 View all (7 more)
Lymphoma	Stimulate	26230952, 26381553
Lymphoma AIDS Related	Associate	9792301
Lymphoma B Cell	Associate	11238122, 1325212, 16449530, 18056366, 18245523, 19299742, 22628023, 22666399, 23640160, 26147452, 26230952, 26448050, 26464657, 28713071, 30209121, 7780129 View all (1 more)
Lymphoma B Cell Marginal Zone	Associate	9137085, 9767448
Lymphoma Extranodal NK T Cell	Associate	26497849
Lymphoma Follicular	Associate	23297127, 24162786, 27228053
Lymphoma Large B Cell Diffuse	Associate	14701701, 17408400, 18160665, 18633131, 20191326, 22323454, 22609637, 23640160, 23840460, 24162786, 26448050, 27799566, 28060727, 29295936, 29496671 View all (8 more)
Lymphoma Mantle Cell	Associate	20047977, 22915070, 27614429, 27697772, 33648463
Lymphoma Non Hodgkin	Associate	11238122, 16449530, 17408400, 17456057, 18024395, 19066394, 19573080, 20047977, 20191326, 20299965, 23640160, 23840460, 28060727, 28246881, 28713071, 9792301 View all (1 more)
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	8941669
Lymphoma Primary Effusion	Associate	10515891, 32161170, 35914074
Lymphoma T Cell	Associate	16766651, 17408400, 23640160
Lymphoma T Cell Cutaneous	Associate	15514008, 18684941, 21198545, 25681335
Lymphoma T Cell Peripheral	Associate	10748876
Lymphopenia	Associate	33317616, 36263058
Lymphoproliferative Disorders	Associate	26147452, 40262247
Macrophage Activation Syndrome	Associate	12449174, 24098711, 26509874
Macular Degeneration	Associate	33953642
Macular Degeneration	Stimulate	35370941
Macular Edema	Inhibit	24319335
Malaria	Associate	20144201, 29033373, 30239833, 37060041
Malaria	Stimulate	28033393, 34962938
Malaria	Inhibit	30380038
Malaria Cerebral	Associate	23614351
Malaria Falciparum	Stimulate	22682094
Malaria Falciparum	Associate	24520384, 32513854
Malignant Teratocarcinosarcoma	Associate	24741599, 25875601
Mastodynia	Associate	24411993
Melanoma	Associate	15579430, 16615096, 16801397, 16835788, 17565341, 18249038, 19142637, 19240164, 21317876, 21327637, 21853302, 24130734, 25604082, 25720800, 25944800 View all (8 more)
Melanoma	Stimulate	15809206
Melioidosis	Associate	28475641
Memory Disorders	Associate	29201645
Meningitis Bacterial	Associate	11985531
Meningitis Cryptococcal	Associate	26768248, 28486489, 30366814, 8641805
Meningitis Viral	Associate	27914455
Meningococcal Infections	Associate	23595505, 29078758
Meningoencephalitis	Associate	7890425
Mental Disorders	Associate	29178897, 39566744
Metabolic Syndrome	Associate	17652887, 25329057, 26734798, 30256013
Metabolic Syndrome	Stimulate	21289232, 31798282
Metabolic Syndrome	Inhibit	29067980
Microcephaly	Associate	30121258
Migraine Disorders	Associate	39187749
Mikulicz' Disease	Associate	21898360
Milk Hypersensitivity	Associate	23917667
Mitochondrial Diseases	Associate	29078758
Mitral Valve Insufficiency	Associate	36307855
Mixed Dementias	Associate	39880323
Mixed Tumor Malignant	Associate	15921527
Mobility Limitation	Associate	22227623
Monocyte Chemotactic Disorder	Associate	26518043
Mouth Diseases	Stimulate	25412496
Mouth Diseases	Associate	34539639
Mouth Neoplasms	Associate	18383862, 25744234, 29037125, 30912418
Moyamoya Disease	Inhibit	31727941
Mucocutaneous Lymph Node Syndrome	Associate	10233729, 15270865, 19543506, 20339193, 21048327, 21508509, 24659220
Mucocutaneous Lymph Node Syndrome	Stimulate	32884012, 34035116
Mucocutaneous Lymph Node Syndrome	Inhibit	37506144
Mucositis	Associate	16540751
Multiple Myeloma	Associate	11122145, 11886382, 15180863, 18512025, 18830264, 22567049, 23152910, 23232072, 24340030, 25469832, 26545722, 27039771, 27268602, 27732933, 27983725 View all (8 more)
Multiple Myeloma	Inhibit	25341809
Multiple Organ Failure	Associate	16585075
Multiple Sclerosis	Associate	10193428, 11422209, 11956029, 12101075, 15182256, 17944900, 18200504, 20227772, 20357264, 25738751, 25780887, 29067976, 29518260, 34596589, 36870061, 37715818, 9771978 View all (2 more)
Multiple Sclerosis	Inhibit	10320650, 23144765, 36754216
Multiple Sclerosis Relapsing Remitting	Associate	22978757
Musculoskeletal Diseases	Inhibit	19160133
Myasthenia Gravis	Associate	23049601, 30945700, 33136553, 33813453, 34936242
Myasthenia Gravis	Inhibit	25518708, 26826242
Myasthenia Gravis	Stimulate	32508812
Mycobacterium Infections Nontuberculous	Inhibit	23144328
Mycoses	Stimulate	15557653
Mycosis Fungoides	Stimulate	8941670
Myelodysplastic Syndromes	Associate	21511336, 33050756
Myelodysplastic Syndromes	Stimulate	23453286
Myeloproliferative Syndrome Transient	Associate	11966768
Myocardial Infarction	Associate	26505348
Myocardial Infarction	Stimulate	36759072
Myocardial Infarction	Inhibit	37811136
Myocardial Ischemia	Associate	24394869
Myopathies Structural Congenital	Associate	17537769
Myositis	Associate	39946176
Myositis Ossificans	Stimulate	30429363
Myotonic Dystrophy	Associate	11896938, 21414848, 26211001, 26354610, 34830017
Myotonic Dystrophy	Inhibit	33287713
Mysophobia	Associate	32630798, 35432366
N syndrome	Associate	31936183
Nasal Polyps	Associate	19250527, 19639723, 28388587, 29417576, 29580813, 31870738
Nasal Polyps	Stimulate	31928947
Nasopharyngeal Carcinoma	Associate	16059673, 21543473, 22320262, 22745579, 25948470, 36039641
Nasopharyngeal Neoplasms	Associate	25544502, 30762321
Necrosis	Associate	29135655
Neonatal hemochromatosis	Inhibit	20130127
Neonatal hemochromatosis	Associate	34152493
Neoplasm Metastasis	Associate	17537769, 21317876, 25129439, 26503210, 28496107, 30485902, 37640741, 39334238, 7553683
Neoplasm Metastasis	Stimulate	32298379
Neoplasms	Associate	10433946, 10886511, 10997808, 11238122, 11509647, 11549573, 11698282, 11828261, 12239181, 12942579, 15162438, 15188028, 15217509, 15308326, 15345504 View all (142 more)
Neoplasms	Stimulate	18685848, 19079205, 19240164, 19289577, 24073274, 25041527, 25058349, 26885615, 27136203, 31186414, 31233202, 31827382, 34727230, 9137085
Neoplasms	Inhibit	24762057, 26528857, 28488547, 30081891
Neoplasms Squamous Cell	Associate	16343245, 33479027
Nephritis	Associate	30779760
Nephritis Interstitial	Associate	30779760
Nephrosis congenital	Associate	35293350
Nephrotic Syndrome	Stimulate	20446793
Nephrotic Syndrome	Inhibit	30062391
Nephrotic Syndrome	Associate	35293350
Nervous System Diseases	Associate	24394869, 31166487, 32038109
Neuralgia	Associate	36860843
Neuralgia Postherpetic	Associate	25127283
Neuroblastoma	Associate	25961062, 27322426, 28687069, 33252831, 8640845
Neuromyelitis Optica	Inhibit	28946890
Neuromyelitis Optica	Associate	40103346
Neurotoxicity Syndromes	Inhibit	8548541
Neutrophilia Hereditary	Inhibit	38497670
No Reflow Phenomenon	Associate	26097597
Non alcoholic Fatty Liver Disease	Associate	20473581, 34025683, 35069014, 37342340
Non Muscle Invasive Bladder Neoplasms	Associate	35338085, 37452272
Non Radiographic Axial Spondyloarthritis	Associate	17665434
Non ST Elevated Myocardial Infarction	Stimulate	28474494
Noncommunicable Diseases	Associate	23378732
Nonsyndromic Holoprosencephaly	Associate	28675120
Nose Diseases	Associate	28388587, 33919374
Obesity	Associate	19267370, 19760027, 19798061, 20825686, 24690978, 27977792, 28225860, 30256013, 34296200, 34620218, 35205336, 36313784
Obesity	Inhibit	21901025, 22912426, 25944984, 27494857, 28537431
Obesity	Stimulate	24741586, 29405562, 32469992, 34330510, 34382943
Obesity Abdominal	Associate	28103807
Obesity Morbid	Associate	32545403
Oculocutaneous albinism type 2	Stimulate	31415412
Olfaction Disorders	Associate	33629532
Opioid Related Disorders	Inhibit	31687981
Oral Ulcer	Associate	26125891, 34032699, 37653793
Organizing Pneumonia	Associate	36263058
Oropharyngeal Neoplasms	Associate	20112337
Ossification Heterotopic	Associate	30429363
Osteoarthritis	Associate	15880595, 27519904, 28316377, 29763932, 33953899, 36619785
Osteoarthritis	Stimulate	26711868, 31017304
Osteoarthritis	Inhibit	27044824
Osteogenesis imperfecta type 3	Associate	16343245
Osteomyelitis	Associate	26135971
Osteonecrosis	Associate	22975999
Osteoporosis	Associate	21200384, 25384921, 32080087, 34207210, 36032115, 37495941, 38567587, 39375626
Osteoporotic Fractures	Associate	34207210
Osteosarcoma	Associate	26503210, 32016959
Otitis Media	Associate	24718616, 26496338
Ovalocytosis Hereditary Hemolytic with Defective Erythropoiesis	Associate	9731054
Ovarian Diseases	Stimulate	28868628
Ovarian Hyperstimulation Syndrome	Stimulate	26823856
Ovarian Neoplasms	Associate	11570587, 1502188, 16617566, 17579858, 17593856, 19398128, 22083345, 24446182, 28327095, 28410380, 28589429, 36056141, 37155466
Ovarian Neoplasms	Stimulate	20430716, 37322531
Overweight	Stimulate	21478181, 29405562
Overweight	Inhibit	28537431
Overweight	Associate	34090357, 35205336
Pain	Associate	23149083, 23864770, 24411993, 31205078, 31221509, 32487996
Pancreatic Neoplasms	Associate	10433946, 16094523, 21455317, 22731825, 26191284, 27589570, 31424683, 32867538, 33299656
Pancreatic Neoplasms	Inhibit	25557640
Pancreatic Neoplasms	Stimulate	37455016
Pancreatitis	Associate	19442309, 26634555, 26823862, 27173345, 28293095
Pancreatitis Alcoholic	Associate	24835349
Pancreatitis Chronic	Associate	17962362
Panuveitis	Stimulate	15606623
Papilloma	Associate	36154611
Papillomavirus Infections	Associate	23118878, 23430974, 23800422, 25412954, 29935877
Paracoccidioidomycosis	Associate	20643858, 25204704
Paraneoplastic Syndromes	Associate	32771066
Paraparesis Tropical Spastic	Associate	28376092, 28910419, 30466392
Parasitic Diseases	Associate	25941808
Parkinson Disease	Associate	24593806, 35279225, 38231411
Parkinson Disease	Stimulate	27220776, 27230441
Parkinson Disease	Inhibit	31455413, 34349163
Parkinson Disease Secondary	Associate	31559531
Pdgfra Associated Chronic Eosinophilic Leukemia	Associate	29580813
Pdgfra Associated Chronic Eosinophilic Leukemia	Stimulate	31928947
pediatric multisystem inflammatory disease COVID 19 related	Stimulate	34035116
Pediatric Obesity	Associate	30809229
Peeling Skin Syndrome	Stimulate	32749463
Pemphigoid Bullous	Associate	11710918, 35140724
Pemphigoid Bullous	Stimulate	29335495, 31440247
Pemphigus	Associate	16946717
Peptic Ulcer	Associate	10655986, 25888319, 33851594
Peri Implantitis	Associate	22425265
Periapical Diseases	Associate	34539639
Periapical Granuloma	Associate	19026878
Periodic fever familial autosomal dominant	Stimulate	29588275
Periodontal Diseases	Associate	27737359, 29538476, 35665507, 39337647
Periodontitis	Associate	10632663, 29538476, 29899423, 32236319, 36214094, 37240180, 39266981, 39336814, 8608641
Periodontitis	Inhibit	35665507
Peripheral Arterial Disease	Associate	12164877, 20385468, 24699044, 40761788
Peritonitis	Stimulate	34360900
Persian Gulf Syndrome	Associate	23800166
Persistent Infection	Associate	18093884
Persistent Infection	Stimulate	20144201, 32408187
Personality Disorders	Associate	39566744
Pigmentary Disorder Reticulate with Systemic Manifestations	Associate	30890581
Pituitary Neoplasms	Stimulate	34257554
Plague	Associate	21106776
Plaque Amyloid	Stimulate	29070909
Plaque Amyloid	Associate	32050932
Plasma Cell Granuloma Pulmonary	Associate	12603603
Platelet Signal Processing Defect	Associate	37986047
Pleural Effusion Malignant	Associate	29785404
Pneumococcal Infections	Associate	30425273
Pneumonia	Associate	20884746, 24804995, 35222434
Pneumonia	Stimulate	22734496
Pneumonia Bacterial	Associate	12556011
Polycystic Kidney Diseases	Associate	27491076
Polycystic Ovary Syndrome	Associate	21478181
Polycystic Ovary Syndrome	Inhibit	28868943
Polycythemia Vera	Associate	9731054
Polymyalgia Rheumatica	Associate	17133531
Polyps	Inhibit	28388587
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Associate	37626843
Polyradiculoneuropathy Chronic Inflammatory Demyelinating	Stimulate	37638717
Polysaccharide Storage of Unusual	Associate	22226452
Post Acute COVID 19 Syndrome	Stimulate	33193384
Post Acute COVID 19 Syndrome	Associate	37497655, 37753077, 39578766
Post Infectious Disorders	Associate	15786508, 26473365, 28410580
Posterior Leukoencephalopathy Syndrome	Stimulate	29271478
Postoperative Complications	Associate	31931724
Postoperative Hemorrhage	Associate	26052959
Pre Eclampsia	Inhibit	19036437
Pre Eclampsia	Associate	19407822, 24612145, 24962617, 25461403, 28502089
Pre Eclampsia	Stimulate	38382266
Precancerous Conditions	Associate	25458044
Precancerous Conditions	Stimulate	31233202
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	32767331, 37530244
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	26932518
Preeclamptic toxemia	Associate	19407822, 31138166
Pregnancy Complications	Associate	18382869, 26844497
Premature Birth	Associate	27486805
Premature Birth	Inhibit	34195300
Primary hyperoxaluria type 1	Associate	27161247
Primary Immunodeficiency Diseases	Associate	38644452
Primary Ovarian Insufficiency	Associate	37710281
Prodromal Symptoms	Associate	22126569
Prostate Cancer Hereditary 7	Associate	19474090
Prostatic Hyperplasia	Associate	21532858
Prostatic Intraepithelial Neoplasia	Associate	17094460
Prostatic Neoplasms	Associate	11238122, 12771930, 17094460, 19267370, 19474090, 20735825, 22647697, 22859398, 23754304, 25921117, 28073842, 28317149, 28631559, 31892550, 35821621, 38087324, 39518934 View all (2 more)
Prostatic Neoplasms	Inhibit	26528857
Prostatic Neoplasms	Stimulate	31348843, 33402974
Prostatitis	Associate	17094460, 19267370, 25177683, 25921117, 31415412
Protein Energy Malnutrition	Associate	38017491
Pruritic urticarial papules plaques of pregnancy	Associate	29317264
Psoriasis	Associate	10469306, 11180010, 11407990, 29696068, 35848967
Pulmonary Alveolar Proteinosis	Stimulate	14567558
Pulmonary Arterial Hypertension	Inhibit	12376215
Pulmonary Atelectasis	Associate	34089082
Pulmonary Disease Chronic Obstructive	Associate	17690329, 19279357, 23537276, 24805101, 26043025, 28976240, 29535517, 31503552, 32273692, 33223825, 34079246, 34206428, 34426754, 35186226, 36253785, 36780897 View all (1 more)
Pulmonary Disease Chronic Obstructive	Stimulate	22363778, 29149779
Pulmonary Disease Chronic Obstructive	Inhibit	27199554, 30154651
Pulmonary edema of mountaineers	Associate	33393628
Pulmonary Embolism	Stimulate	33969714
Purpura	Inhibit	35808925
Purpura Thrombocytopenic Idiopathic	Associate	12176899, 15755291, 21756542, 24338252, 25057496, 28466476, 31858561, 32419211, 32574429, 34299256, 35808925, 37660478, 8639783
Purpura Thrombocytopenic Idiopathic	Inhibit	22859611, 26111958, 27391055, 27554456, 31380412, 32677050, 37208911
Q Fever	Associate	11254592, 31001808
Q Fever	Stimulate	8926081
Radiation Pneumonitis	Associate	34964782
Recurrent respiratory papillomatosis	Associate	15138179, 36154611
Renal Artery Obstruction	Inhibit	38031731
Renal Insufficiency	Associate	29227971, 30606202
Renal Insufficiency Chronic	Inhibit	24111715
Renal Insufficiency Chronic	Associate	32046176, 38017491
Renal Insufficiency Chronic	Stimulate	40184113
Respiratory Distress Syndrome	Associate	16585075, 28298812, 28432351, 33422148, 34163488, 34646263, 39365167
Respiratory Distress Syndrome In Premature Infants	Associate	28298812
Respiratory Insufficiency	Associate	22533231, 27368016
Respiratory Sounds	Associate	23273955, 26473365
Respiratory Sounds	Stimulate	32628310
Respiratory Syncytial Virus Infections	Stimulate	17460443
Respiratory Syncytial Virus Infections	Associate	21910858, 28228284
Respiratory System Abnormalities	Associate	12164877
Respiratory Tract Diseases	Associate	21357384, 31936183, 35456412
Respiratory Tract Infections	Associate	20484443
Respiratory Tract Infections	Inhibit	24718616
Retinal Artery Occlusion	Associate	17438520
Retinal Diseases	Associate	28128370
Retinal Necrosis Syndrome Acute	Stimulate	28395298
Retinal Vein Occlusion	Associate	31814701, 35370941
Rhabdomyosarcoma	Associate	23797008
Rheumatic Diseases	Associate	24896159
Rheumatic Fever	Associate	24896159
Rheumatoid Nodule	Associate	12571841
Rhinitis Allergic	Associate	20232770, 21625018, 22533231, 31598989, 33224143, 35064698, 35415925
Rhinitis Allergic	Inhibit	35190755
Ring Chromosome 20 Syndrome	Stimulate	28578351
Root Resorption	Stimulate	28782095
Rufous oculocutaneous albinism	Associate	16189158
Sarcoidosis	Stimulate	12746045, 15303638
Sarcoidosis	Associate	18654018, 19117745, 22927996
Sarcoidosis Pulmonary	Associate	12746045
Sarcoma Ewing	Stimulate	34440851
Sarcoma Kaposi	Associate	31629226, 37740179
Sarcoma Myeloid	Associate	37530244
Schizophrenia	Associate	20132993, 23951054, 26462458, 32038109
Schizophrenia	Inhibit	24984193, 30630651
Scleroderma Diffuse	Associate	33809015
Scleroderma Systemic	Associate	11710721, 23237063, 28103916, 34504485
Scleroderma Systemic	Inhibit	29689251
Seizures	Associate	23614351
Seizures Febrile	Associate	26076859, 35022648
Sepsis	Associate	16444434, 18949559, 20835611, 21048935, 22180561, 22187279, 24470136, 26632390, 27368016, 32996896, 35720398, 37304268
Sepsis Associated Encephalopathy	Associate	39966958
Severe Acute Respiratory Syndrome	Associate	17052299, 18972133, 37261339
Severe Acute Respiratory Syndrome	Inhibit	23747854, 36949406
Severe Acute Respiratory Syndrome	Stimulate	32217835
Severe Combined Immunodeficiency	Associate	7905018
Severe Dengue	Associate	25589894
Severe Fever with Thrombocytopenia Syndrome	Associate	37903435
Sexual Dysfunction Physiological	Associate	26945392
Sezary Syndrome	Stimulate	7923918
Shock	Associate	16038043
Shock Septic	Associate	16038043, 22607204, 24091885, 33613540, 8224211
Shoulder Pain	Stimulate	37864374
Sjogren's Syndrome	Associate	11212157, 14872501, 17470266, 26332048, 29504848, 30882006, 33228011, 35705251, 37418983, 39337678, 39819714, 7578884, 9867125
Sjogren's Syndrome	Stimulate	39480501
Skin Diseases	Inhibit	11348460
Skin Diseases	Associate	11564829, 19479852, 21357384, 23273955, 25759212, 26015771, 31440247, 7923918, 8941669
Skin Diseases	Stimulate	16185274, 37740179
Skin Manifestations	Associate	10343522
Skin Neoplasms	Associate	12535204, 21760883
Sleep Apnea Obstructive	Inhibit	25944984
Sleep Apnea Syndromes	Associate	31882693
Soft Tissue Injuries	Inhibit	29580813
Spinal Cord Injuries	Associate	25860946
Spondylarthropathies	Associate	10733472, 11302872
Spondylitis Ankylosing	Associate	22494514, 26823867, 34290697, 35420296, 38346238
Squamous Cell Carcinoma of Head and Neck	Stimulate	17465207, 18547033
Squamous Cell Carcinoma of Head and Neck	Associate	18383862, 20592893, 22167499, 23118878, 23679256, 28052009, 28053372, 28496107, 30912418, 33419896, 33569630
Squamous Intraepithelial Lesions	Associate	34106897, 40754553, 9472685
Squamous Intraepithelial Lesions	Stimulate	9717966
ST Elevation Myocardial Infarction	Associate	25814225, 28474494
Staphylococcal Infections	Associate	26225421, 33256638
Staphylococcal Infections	Inhibit	31527248
Status Asthmaticus	Associate	10955758, 11132771, 14738236, 14748015, 16341266, 17951166, 20705942, 23527710, 25759826, 30013989, 33400919
Status Asthmaticus	Inhibit	20816188, 29384117
Stickler syndrome type 1	Associate	22306269
Still's Disease Adult Onset	Associate	33552062, 37153620
Stomach Diseases	Associate	19295440, 25888319, 31983108
Stomach Neoplasms	Associate	15682481, 19132772, 19822020, 21455338, 22126569, 22235320, 23725178, 24120241, 25884934, 26088449, 26378021, 28002581, 28111424, 28596683, 29742730 View all (6 more)
Stomach Neoplasms	Inhibit	22526791, 31092242
Stomach Neoplasms	Stimulate	28488547, 30785523, 31233202, 37153541
Stress Disorders Post Traumatic	Stimulate	30777365
Stress Disorders Post Traumatic	Associate	35312143
Stroke	Associate	24394869, 39199367, 40362194
Stroke	Inhibit	34201498
Subarachnoid Hemorrhage	Associate	40362194
Sutton disease 2	Associate	35660731
Sveinsson Chorioretinal Atrophy	Stimulate	28434701
Synovitis	Associate	22494514, 9358757
Syphilis	Associate	32532356
Syphilis Latent	Associate	28143443
Syphilis secondary	Associate	28143443
Systemic Inflammatory Response Syndrome	Associate	12554901, 16276011
Systemic Vasculitis	Associate	19543506, 20037209
T cell immunodeficiency primary	Associate	22496237
Temporomandibular Joint Dysfunction Syndrome	Associate	36445911
Tendinopathy	Associate	29385715
Tertiary Lymphoid Structures	Associate	20553628, 29390966
Thrombocytopenia	Associate	25589894
Thyroid Cancer Papillary	Associate	24379064, 32348468
Thyroid Neoplasms	Associate	16452205, 21876975, 27858102
Thyroiditis	Inhibit	31350776
Thyroiditis Autoimmune	Associate	21876975, 33620087, 9697995
Thyroiditis Autoimmune	Inhibit	31790305
Toxoplasmosis Ocular	Associate	29426041
Trachoma	Associate	15557667
Trauma Nervous System	Associate	31166487
Tremor	Inhibit	26090964
Triple Negative Breast Neoplasms	Associate	35255925, 35960749
Trypanosomiasis African	Associate	26090964
Tuberculosis	Associate	12869034, 15102771, 15373915, 16279841, 16313368, 17921069, 19412539, 20883321, 21314735, 22140472, 23936496, 24379064, 25157980, 25510482, 25887222 View all (9 more)
Tuberculosis	Stimulate	22670716, 32566036
Tuberculosis	Inhibit	31678658
Tuberculosis Lymph Node	Associate	36439164
Tuberculosis Meningeal	Associate	20883321, 23768819, 24971599, 29778672, 29996789, 30696839
Tuberculosis Meningeal	Stimulate	24379064
Tuberculosis Multidrug Resistant	Associate	27238179, 34424286
Tuberculosis Pleural	Associate	21314735
Tuberculosis Pulmonary	Associate	11500439, 20007364, 23671613, 23768819, 24473766, 25299090, 25887222, 26840977, 27238179, 27311307, 33202583
Tuberculosis Pulmonary	Inhibit	19703020
Tuberculosis Spinal	Associate	31264664
Tubulointerstitial nephritis and uveitis	Associate	30779760
Tympanic Membrane Perforation	Associate	26496338
Tyrosine Kinase 2 Deficiency	Stimulate	29725107
Ulcer	Associate	16622230, 26015771
Ureaplasma Infections	Associate	29234642
Uremia	Associate	11737614
Ureteral Calculi	Associate	30484290
Urinary Bladder Neoplasms	Associate	25050631, 31823416, 35909123
Urinary Bladder Overactive	Associate	31166487
Urinary Tract Infections	Stimulate	30484290
Uterine Cervical Diseases	Stimulate	19079205
Uterine Cervical Diseases	Associate	9472685
Uterine Cervical Dysplasia	Associate	10209502, 23521696, 32277624
Uterine Cervical Dysplasia	Stimulate	19079205, 31316301
Uterine Cervical Dysplasia	Inhibit	19089920, 35313793
Uterine Cervical Neoplasms	Associate	11509647, 19823053, 22592655, 23280621, 23587428, 23656504, 25412954, 27220278, 27525910, 27721577, 29935877, 30453149, 30517305, 31316301, 32277624 View all (5 more)
Uterine Cervical Neoplasms	Stimulate	25309919
Uterine Cervical Neoplasms	Inhibit	31943744, 32277624
Uterine Cervicitis	Associate	16343245, 23800422, 23936772, 28858203, 40754553
Uterine Cervicitis	Inhibit	19089920
Uterine Diseases	Associate	24260517, 36263059
Uveitis	Stimulate	15606623, 33639877
Uveitis	Associate	18802119, 24612100, 27028890, 29774027, 30779760, 40433375
Uveitis	Inhibit	25354724
Uveitis Anterior	Stimulate	15606623
Uveitis Anterior	Associate	25200001, 38346238
Uveitis Intermediate	Associate	16024856, 23378732
Uveomeningoencephalitic Syndrome	Associate	20591073
Vaginosis Bacterial	Associate	26844497
Vascular Diseases	Associate	20385468, 28693373
Vascular Malformations	Associate	31727941
Vascular System Injuries	Associate	19543506
Vasculitis	Associate	25376552
Venous Thromboembolism	Associate	20031567
Virus Diseases	Associate	18062799, 29439673, 29725107, 35408809, 36882862
Vision Disorders	Associate	34424286
Vitiligo	Associate	18057536, 32295963
Vitiligo	Inhibit	26370050
Vitreoretinopathy Proliferative	Stimulate	28572674
Vulvar Neoplasms	Associate	9067409
Waldenstrom Macroglobulinemia	Associate	19573080, 29496671
Weight Loss	Associate	19244371
Wounds and Injuries	Associate	11224628, 28316377, 34517005, 37102649, 8621803
Wounds and Injuries	Stimulate	34172608
Yellow Fever	Stimulate	19906894, 37952362

IL10 (interleukin 10)