Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3579
Gene name Gene Name - the full gene name approved by the HGNC.	C-X-C motif chemokine receptor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	CXCR2
Synonyms (NCBI Gene) Gene synonyms aliases	CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB, WHIMS2
Chromosome Chromosome number	2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	2q35
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system.

Show/Hide all(1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1574542732	A>T	Likely-pathogenic	Coding sequence variant, stop gained

Show/Hide all(134)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017358	hsa-miR-335-5p	Microarray	18185580
MIRT647735	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT647734	hsa-miR-4293	HITS-CLIP	23824327
MIRT647727	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT647733	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT647732	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT647731	hsa-miR-1306-3p	HITS-CLIP	23824327
MIRT647730	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT647729	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT647728	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT647727	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT647726	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT647725	hsa-miR-548s	HITS-CLIP	23824327
MIRT647724	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT647723	hsa-miR-588	HITS-CLIP	23824327
MIRT647722	hsa-miR-4435	HITS-CLIP	23824327
MIRT647721	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT647720	hsa-miR-5096	HITS-CLIP	23824327
MIRT732336	hsa-miR-22-3p	Flow, Gluc reporter assay, GUS reporter assay, HITS-CLIP, Immunoblot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunoprecipitaion	26364720
MIRT732336	hsa-miR-22-3p	Flow, Gluc reporter assay, GUS reporter assay, HITS-CLIP, Immunoblot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunoprecipitaion	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot, RNA immunoprecipitation assay (RIP)	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot, RNA immunoprecipitation assay (RIP)	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot, RNA immunoprecipitation assay (RIP)	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot,	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot,	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot,	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot,	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot,	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot,	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot,	26364720
MIRT732336	hsa-miR-22-3p	Luciferase reporter assay, Western blot,	26364720
MIRT647735	hsa-miR-4524b-3p	HITS-CLIP	23824327
MIRT647734	hsa-miR-4293	HITS-CLIP	23824327
MIRT647727	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT647733	hsa-miR-6823-5p	HITS-CLIP	23824327
MIRT647732	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT647731	hsa-miR-1306-3p	HITS-CLIP	23824327
MIRT647730	hsa-miR-29a-5p	HITS-CLIP	23824327
MIRT647729	hsa-miR-3194-5p	HITS-CLIP	23824327
MIRT647728	hsa-miR-6832-5p	HITS-CLIP	23824327
MIRT647727	hsa-miR-411-5p	HITS-CLIP	23824327
MIRT647726	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT647725	hsa-miR-548s	HITS-CLIP	23824327
MIRT647724	hsa-miR-4701-5p	HITS-CLIP	23824327
MIRT647723	hsa-miR-588	HITS-CLIP	23824327
MIRT647722	hsa-miR-4435	HITS-CLIP	23824327
MIRT647721	hsa-miR-3187-3p	HITS-CLIP	23824327
MIRT647720	hsa-miR-5096	HITS-CLIP	23824327
MIRT918176	hsa-miR-129-5p	CLIP-seq
MIRT918177	hsa-miR-1297	CLIP-seq
MIRT918178	hsa-miR-1307	CLIP-seq
MIRT918179	hsa-miR-142-5p	CLIP-seq
MIRT918180	hsa-miR-145	CLIP-seq
MIRT918181	hsa-miR-149	CLIP-seq
MIRT918182	hsa-miR-26a	CLIP-seq
MIRT918183	hsa-miR-26b	CLIP-seq
MIRT918184	hsa-miR-3064-5p	CLIP-seq
MIRT918185	hsa-miR-3149	CLIP-seq
MIRT918186	hsa-miR-411	CLIP-seq
MIRT918187	hsa-miR-4279	CLIP-seq
MIRT918188	hsa-miR-4284	CLIP-seq
MIRT918189	hsa-miR-4465	CLIP-seq
MIRT918190	hsa-miR-4532	CLIP-seq
MIRT918191	hsa-miR-4638-5p	CLIP-seq
MIRT918192	hsa-miR-4772-3p	CLIP-seq
MIRT918193	hsa-miR-4794	CLIP-seq
MIRT918194	hsa-miR-561	CLIP-seq
MIRT918195	hsa-miR-1298	CLIP-seq
MIRT918179	hsa-miR-142-5p	CLIP-seq
MIRT918196	hsa-miR-3160-5p	CLIP-seq
MIRT918197	hsa-miR-337-3p	CLIP-seq
MIRT918198	hsa-miR-4263	CLIP-seq
MIRT918199	hsa-miR-4265	CLIP-seq
MIRT918200	hsa-miR-4296	CLIP-seq
MIRT918201	hsa-miR-4322	CLIP-seq
MIRT918202	hsa-miR-4708-3p	CLIP-seq
MIRT918203	hsa-miR-4799-5p	CLIP-seq
MIRT918194	hsa-miR-561	CLIP-seq
MIRT918204	hsa-miR-576-5p	CLIP-seq
MIRT918205	hsa-miR-664	CLIP-seq
MIRT1972147	hsa-miR-4735-5p	CLIP-seq
MIRT1972148	hsa-miR-4775	CLIP-seq
MIRT1972149	hsa-miR-590-3p	CLIP-seq
MIRT2207967	hsa-miR-122	CLIP-seq
MIRT2207968	hsa-miR-1224-5p	CLIP-seq
MIRT918195	hsa-miR-1298	CLIP-seq
MIRT2207969	hsa-miR-1304	CLIP-seq
MIRT918179	hsa-miR-142-5p	CLIP-seq
MIRT2207970	hsa-miR-150	CLIP-seq
MIRT2207971	hsa-miR-1909	CLIP-seq
MIRT2207972	hsa-miR-197	CLIP-seq
MIRT2207973	hsa-miR-2052	CLIP-seq
MIRT2207974	hsa-miR-22	CLIP-seq
MIRT2207975	hsa-miR-3135b	CLIP-seq
MIRT2207976	hsa-miR-3155	CLIP-seq
MIRT2207977	hsa-miR-3155b	CLIP-seq
MIRT2207978	hsa-miR-320a	CLIP-seq
MIRT2207979	hsa-miR-320b	CLIP-seq
MIRT2207980	hsa-miR-320c	CLIP-seq
MIRT2207981	hsa-miR-320d	CLIP-seq
MIRT2207982	hsa-miR-3652	CLIP-seq
MIRT2207983	hsa-miR-3915	CLIP-seq
MIRT2207984	hsa-miR-3928	CLIP-seq
MIRT2207985	hsa-miR-4429	CLIP-seq
MIRT2207986	hsa-miR-4430	CLIP-seq
MIRT2207987	hsa-miR-4688	CLIP-seq
MIRT2207988	hsa-miR-4689	CLIP-seq
MIRT2207989	hsa-miR-4713-5p	CLIP-seq
MIRT1972147	hsa-miR-4735-5p	CLIP-seq
MIRT2207990	hsa-miR-4769-3p	CLIP-seq
MIRT1972148	hsa-miR-4775	CLIP-seq
MIRT2207991	hsa-miR-484	CLIP-seq
MIRT2207992	hsa-miR-532-3p	CLIP-seq
MIRT918194	hsa-miR-561	CLIP-seq
MIRT1972149	hsa-miR-590-3p	CLIP-seq
MIRT918205	hsa-miR-664	CLIP-seq
MIRT918180	hsa-miR-145	CLIP-seq
MIRT918187	hsa-miR-4279	CLIP-seq
MIRT2465159	hsa-miR-3138	CLIP-seq
MIRT2465160	hsa-miR-4329	CLIP-seq
MIRT2465161	hsa-miR-4786-5p	CLIP-seq
MIRT2465162	hsa-miR-548b-3p	CLIP-seq
MIRT2465163	hsa-miR-769-5p	CLIP-seq
MIRT918176	hsa-miR-129-5p	CLIP-seq
MIRT918185	hsa-miR-3149	CLIP-seq
MIRT1972147	hsa-miR-4735-5p	CLIP-seq
MIRT1972148	hsa-miR-4775	CLIP-seq
MIRT1972149	hsa-miR-590-3p	CLIP-seq
MIRT918176	hsa-miR-129-5p	CLIP-seq
MIRT918185	hsa-miR-3149	CLIP-seq
MIRT1972147	hsa-miR-4735-5p	CLIP-seq
MIRT1972148	hsa-miR-4775	CLIP-seq
MIRT1972149	hsa-miR-590-3p	CLIP-seq

Transcription factors

Show/Hide all(6)

Transcription factor	Regulation	Reference
CEBPA	Unknown	18555777
NFKB1	Activation	19156404
NFKB1	Unknown	18555777
RELA	Activation	19156404
RELA	Unknown	18555777
USF2	Activation	10229837

Show/Hide all(48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002407	Process	Dendritic cell chemotaxis	IEA
GO:0002407	Process	Dendritic cell chemotaxis	TAS	16621978
GO:0004918	Function	Interleukin-8 receptor activity	IDA	10820279
GO:0004918	Function	Interleukin-8 receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IDA	10438939
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004950	Function	Chemokine receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	17435771, 21876773, 22904195, 23597562, 32296183, 36613703
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8194768, 10438939
GO:0006935	Process	Chemotaxis	IDA	10725748
GO:0006935	Process	Chemotaxis	IEA
GO:0006954	Process	Inflammatory response	TAS	9725262
GO:0006955	Process	Immune response	IBA
GO:0006968	Process	Cellular defense response	IDA	10725748
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	9079638
GO:0007166	Process	Cell surface receptor signaling pathway	IDA	10734056, 10878382
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	10438939
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10438939
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009986	Component	Cell surface	IDA	10878382
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IDA	10725748
GO:0016020	Component	Membrane	IEA
GO:0016493	Function	C-C chemokine receptor activity	IBA
GO:0016494	Function	C-X-C chemokine receptor activity	IDA	10878382
GO:0016494	Function	C-X-C chemokine receptor activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019957	Function	C-C chemokine binding	IBA
GO:0019959	Function	Interleukin-8 binding	IEA
GO:0019959	Function	Interleukin-8 binding	IPI	1840701
GO:0030593	Process	Neutrophil chemotaxis	IBA
GO:0030593	Process	Neutrophil chemotaxis	IDA	10820279
GO:0030667	Component	Secretory granule membrane	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031623	Process	Receptor internalization	IDA	10734056
GO:0031623	Process	Receptor internalization	IEA
GO:0038112	Process	Interleukin-8-mediated signaling pathway	IDA	10820279
GO:0042119	Process	Neutrophil activation	IDA	10878382
GO:0042629	Component	Mast cell granule	IDA	9725262
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0070098	Process	Chemokine-mediated signaling pathway	IEA
GO:0072686	Component	Mitotic spindle	IDA

MIM	HGNC	e!Ensembl
146928	6027	ENSG00000180871

Protein

UniProt ID

P25025

Protein name

C-X-C chemokine receptor type 2 (CXC-R2) (CXCR-2) (CDw128b) (GRO/MGSA receptor) (High affinity interleukin-8 receptor B) (IL-8R B) (IL-8 receptor type 2) (CD antigen CD182)

Protein function

Receptor for interleukin-8 which is a powerful neutrophil chemotactic factor (PubMed:1891716). Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calc

PDB

4Q3H , 5TYT , 6KVA , 6KVF , 6LFM , 6LFO , 8XVU , 8XWA , 8XWF , 8XWM , 8XWN , 8XWS , 8XWV , 8XX3 , 8XX6 , 8XX7 , 8XXH , 8XXR , 8XXX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	65 → 314	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL

Sequence length

360

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Chemokine signaling pathway Phospholipase D signaling pathway Endocytosis Epithelial cell signaling in Helicobacter pylori infection Human cytomegalovirus infection		Chemokine receptors bind chemokines G alpha (i) signalling events Neutrophil degranulation

Show/Hide Unknown Diseases (4)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Congenital Neutropenia	autosomal recessive severe congenital neutropenia due to CXCR2 deficiency	N/A	N/A	GenCC
Crohn Disease	Crohn's disease	N/A	N/A	GWAS
Inflammatory Bowel Disease	Inflammatory bowel disease	N/A	N/A	GWAS
Ulcerative colitis	Ulcerative colitis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (185)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	17360650
Acute On Chronic Liver Failure	Inhibit	27974825
Adenocarcinoma	Associate	25485576, 33935122, 35212311
Adenocarcinoma of Lung	Inhibit	35768814
Adenomyosis	Associate	16500343
Alzheimer Disease	Associate	33804025
Aortic Aneurysm Abdominal	Stimulate	16308497
Appendicitis	Stimulate	27417541
Arterial Occlusive Diseases	Associate	16308497
Arthritis Psoriatic	Stimulate	15482477
Arthritis Psoriatic	Associate	9424095
Arthritis Rheumatoid	Associate	12932287, 33087182, 8863160
Asthma	Associate	17234659, 31903716, 33602227
Asthma	Stimulate	24641287
Astrocytoma	Associate	22231733, 9334359
Atherosclerosis	Associate	36094626
Atrial Fibrillation	Associate	30760287, 32383373, 33755965, 35305619, 35790963, 36042613
beta Thalassemia	Inhibit	31884679
Bile Duct Neoplasms	Associate	18676870
Biliary Tract Neoplasms	Associate	18676870
Brain Diseases	Associate	12244149
Brain Injuries Traumatic	Stimulate	35768823
Brain Neoplasms	Associate	33807899
Breast Neoplasms	Associate	20540789, 22789011, 23149820, 32702599, 35280694
Calculi	Associate	18676870
Cap Myopathy	Associate	24970800
Carcinoid Tumor	Stimulate	10747307
Carcinoma Endometrioid	Associate	36140779
Carcinoma Hepatocellular	Associate	26503598, 27807540, 31684995, 35038357, 36411463, 37403022
Carcinoma Non Small Cell Lung	Associate	21298036, 31731888, 33669233
Carcinoma Pancreatic Ductal	Associate	40269781
Carcinoma Renal Cell	Associate	24593195, 27273823, 27297979, 28923105
Carcinoma Small Cell	Associate	22389383, 25512615
Cardiomyopathies	Associate	36936778
Carotid Stenosis	Stimulate	16308497
Cerebral Infarction	Associate	26648969, 31883451
Cerebral Small Vessel Diseases	Associate	31883451
Chagas Cardiomyopathy	Associate	29160519
Chest Pain	Associate	25222246
Cholangiocarcinoma	Associate	35377900
Chronic Periodontitis	Associate	22051099, 30863202
Colitis Collagenous	Stimulate	25948880
Colitis Lymphocytic	Associate	25948880
Colitis Ulcerative	Associate	32190668, 36860851, 39328405
Colonic Diseases	Associate	35879507
Colonic Neoplasms	Associate	12496258
Colorectal Neoplasms	Associate	18959627, 21285972, 21791631, 22674296, 25541970, 25580640, 28415702, 30820706, 34083590, 35212311, 35687912
COVID 19	Associate	32581077, 33246355, 36622345
COVID 19	Stimulate	37946732
Crohn Disease	Associate	35795659
Cushing's symphalangism	Associate	22152684
Cystic Disease Of Lung	Associate	22088968
Cystic Fibrosis	Associate	19046427, 22088968
Cytomegalovirus Infections	Associate	18471037
Death	Associate	23293110
Dental Caries	Associate	23470693
Depressive Disorder Major	Associate	31431611
Diabetes Mellitus	Associate	31010531
Diabetic Nephropathies	Associate	36329882, 36919187
Diarrhea	Associate	25222246
Drug Hypersensitivity	Stimulate	24641287
Drug Hypersensitivity	Associate	25973893
Encephalitis Tick Borne	Associate	29678185
Endometriosis	Associate	30015967
Epidermolysis Bullosa	Associate	28736230
Epstein Barr Virus Infections	Associate	36992360
Esophageal Neoplasms	Associate	19435811, 26231560
Esophageal Squamous Cell Carcinoma	Associate	31485619
Esophageal Squamous Cell Carcinoma	Inhibit	38401086
Essential Hypertension	Associate	26648969
Familial Primary Pulmonary Hypertension	Associate	33478117
Fatigue	Associate	36922030
Fatty Liver	Stimulate	23661906
Feeding and Eating Disorders	Associate	25222246
Fibrosis	Inhibit	31953139
Gallstones	Associate	18676870
Gastroesophageal Reflux	Inhibit	15793866
Glioblastoma	Associate	23029099, 30086759, 33807899, 35856448, 37686093
Glioma	Associate	33089764
Glomerulonephritis IGA	Stimulate	24023680
Graves Disease	Associate	37730733
Growth Disorders	Associate	10196223, 11076803, 9079638
Hashimoto Disease	Associate	37730733
Headache	Associate	25222246
Hemoglobinuria Paroxysmal	Associate	28151558
HIV Infections	Associate	25222246
HIV Infections	Stimulate	27163710
HTLV I Infections	Associate	11139191
Hyperphagia	Associate	31431611
Hypoxia Brain	Stimulate	24551277
Idiopathic Pulmonary Fibrosis	Associate	39991151
Immunoglobulin G4 Related Disease	Associate	25973893
Infections	Stimulate	16926411
Infections	Associate	36992360, 40353220
Inflammation	Associate	12734381, 18578857, 18676870, 18842429, 18959627, 19252927, 24841946, 24920275, 27151689, 30863202, 32190668, 32581077, 33087182, 33804025
Inflammation	Stimulate	30704100
Inflammatory Bowel Diseases	Associate	35022690
Keloid	Associate	11115149
Kidney Diseases Cystic	Associate	26790439
Kidney Failure Chronic	Associate	26790439
Kidney Neoplasms	Stimulate	27273823
Latent Tuberculosis	Stimulate	26316141
Leukemia	Associate	18842429, 29146966, 36129940
Leukemia Large Granular Lymphocytic	Associate	18842429
Leukemia Myeloid Acute	Associate	26462087
Leukemia Prolymphocytic T Cell	Associate	36129940
Leukocytosis	Associate	32170377
Liver Cirrhosis	Associate	23661906
Liver Cirrhosis	Inhibit	24736615
Liver Diseases	Associate	21731723
Liver Failure	Associate	24736615
Lung Diseases	Associate	33246355
Lung Neoplasms	Associate	19309748, 25480945
Lung Neoplasms	Stimulate	38158808
Lymphatic Metastasis	Stimulate	26497045, 31731888
Lymphatic Metastasis	Associate	28575019, 31793192
Lymphoma	Associate	18842429
Lymphoma Follicular	Associate	35887224
Lymphoma Large B Cell Diffuse	Associate	18633131, 35887224, 39376717
Lymphoproliferative Disorders	Associate	18842429
Melanoma	Associate	19401689, 37686093, 8363581
Mouth Neoplasms	Associate	26462152
Multiple Sclerosis	Associate	30704100
Muscular Dystrophy Duchenne	Associate	28736230
Mysophobia	Associate	30863202
Necrosis	Associate	22231733
Neoplasm Invasiveness	Stimulate	18096634
Neoplasm Metastasis	Associate	21343381, 24593195, 25580640, 27028996, 28415702, 31731578, 35879507, 37166450
Neoplasm Metastasis	Stimulate	27273823
Neoplasms	Associate	12734381, 14632759, 17594938, 18096634, 18578857, 19350238, 20429924, 21285972, 21343381, 21791631, 23359652, 23995780, 24376747, 24593195, 25512615 View all (29 more)
Neoplasms	Stimulate	19401689, 31731888, 32170377, 36411463
Neoplasms	Inhibit	21298036, 35377900, 37403022
Neuroendocrine Tumors	Associate	15920165
Non alcoholic Fatty Liver Disease	Stimulate	23661906
Non alcoholic Fatty Liver Disease	Associate	35790963
Opportunistic Infections	Associate	25222246
Osteoarthritis	Associate	33087182
Ovarian Diseases	Associate	35920183
Ovarian Neoplasms	Associate	19010874, 24376747, 26462152, 27028996, 31793192, 33829065, 34840630
Pancreatic Neoplasms	Associate	23293110, 31731578, 31999765, 32051287, 36012531, 36585453
Pancreatic Neoplasms	Stimulate	32867211
Pancreatitis	Associate	37686093
Parasitic Diseases	Associate	36936778
Periodic fever familial autosomal dominant	Associate	39328405
Peripheral Arterial Disease	Associate	35795659
Peritonitis	Associate	28575019
Pheochromocytoma	Associate	10747307
Pilomatrixoma	Associate	27151689
Pituitary Neoplasms	Associate	10747307
Plasma Cell Granuloma Pulmonary	Associate	26316141
Pneumonia	Associate	33780519
Polyposis Syndrome Hereditary Mixed 1	Associate	19350238
Post Acute COVID 19 Syndrome	Inhibit	36922030
Postoperative Complications	Associate	26231560
Primary Myelofibrosis	Associate	15454487
Prostatic Hyperplasia	Associate	32542667
Prostatic Neoplasms Castration Resistant	Associate	37844613
Prostatitis	Associate	25512615
Psoriasis	Stimulate	15482477
Psoriasis	Associate	9424095
Pulmonary Disease Chronic Obstructive	Associate	35018096
Pyruvate Carboxylase Deficiency Disease	Associate	33458757
Rectal Neoplasms	Stimulate	22674296
Rectal Neoplasms	Associate	25541970
Renal Insufficiency Chronic	Associate	36860851
Reperfusion Injury	Stimulate	33241954
Sarcoma Kaposi	Associate	15110993
Scleroderma Systemic	Associate	10902769
Severe Acute Respiratory Syndrome	Inhibit	31953139
Small Cell Lung Carcinoma	Associate	15545974, 16721367
Squamous Cell Carcinoma of Head and Neck	Associate	27557518, 34911941
Stomach Diseases	Associate	36614059
Stomach Neoplasms	Associate	14632759, 18025257, 21343381, 26497045, 28575019, 35377900, 38319150
Stroke	Associate	26648969, 30760287, 31883451
Thyroid cancer medullary	Associate	10747307
Triple Negative Breast Neoplasms	Associate	30089134
Tuberculosis	Associate	17371589
Urinary Bladder Neoplasms	Inhibit	19252927
Urinary Bladder Neoplasms	Associate	30816487
Uterine Cervical Neoplasms	Associate	24551277, 35264061
Uterine Cervical Neoplasms	Stimulate	37653753
Vasculitis	Inhibit	22152684
Weight Loss	Associate	25222246
Wilms Tumor	Associate	23359652
Wounds and Injuries	Associate	31666007

CXCR2 (C-X-C motif chemokine receptor 2)