IL9 (interleukin 9)

Gene

• Entrez ID: 3578
• Gene name: Interleukin 9
• Gene symbol: IL9
• Synonyms (NCBI Gene): HP40, IL-9, P40
• Chromosome: 5
• Chromosome location: 5q31.1
• Summary: The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates differ

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	24487305
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005140	Function	Interleukin-9 receptor binding	IBA
GO:0005140	Function	Interleukin-9 receptor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	33463482
GO:0005615	Component	Extracellular space	IEA
GO:0006954	Process	Inflammatory response	TAS	9371819
GO:0006955	Process	Immune response	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1680606
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	ISS
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	8756628, 9535918, 10919676, 18829468
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	24487305
GO:0042100	Process	B cell proliferation	IEA
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	IEA

Other IDs

• MIM: 146931
• HGNC: 6029
• e!Ensembl: ENSG00000145839

Protein

• UniProt ID: P15248
• Protein name: Interleukin-9 (IL-9) (Cytokine P40) (T-cell growth factor P40)
• Protein function: Multifunctional cytokine secreted mainly by T-helper 2 lymphocytes and also mast cells or NKT cells that plays important roles in the immune response against parasites (PubMed:29742432). Affects intestinal epithelial permeability and adaptive im
• PDB: 7OX1, 7OX2, 7OX3, 7OX5, 7OX6
• Sequence:

  MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIP
  SDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGN
  ALTFLKSLLEIFQKEKMRGMRGKI

• Sequence length: 144

Pathways

KEGG:

Cytokine-cytokine receptor interaction
JAK-STAT signaling pathway
Asthma

Reactome:

Interleukin-9 signaling