Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3578
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 9
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL9
Synonyms (NCBI Gene) Gene synonyms aliases	HP40, IL-9, P40
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q31.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a cytokine that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin 9 receptor (IL9R), which activates differ

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	24487305
GO:0005125	Function	Cytokine activity	IEA
GO:0005126	Function	Cytokine receptor binding	IEA
GO:0005140	Function	Interleukin-9 receptor binding	IBA
GO:0005140	Function	Interleukin-9 receptor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	33463482
GO:0005615	Component	Extracellular space	IEA
GO:0006954	Process	Inflammatory response	TAS	9371819
GO:0006955	Process	Immune response	IEA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	1680606
GO:0016064	Process	Immunoglobulin mediated immune response	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	ISS
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	8756628, 9535918, 10919676, 18829468
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	24487305
GO:0042100	Process	B cell proliferation	IEA
GO:0046425	Process	Regulation of receptor signaling pathway via JAK-STAT	IEA

MIM	HGNC	e!Ensembl
146931	6029	ENSG00000145839

Protein

UniProt ID

P15248

Protein name

Interleukin-9 (IL-9) (Cytokine P40) (T-cell growth factor P40)

Protein function

Multifunctional cytokine secreted mainly by T-helper 2 lymphocytes and also mast cells or NKT cells that plays important roles in the immune response against parasites (PubMed:29742432). Affects intestinal epithelial permeability and adaptive im

PDB

7OX1 , 7OX2 , 7OX3 , 7OX5 , 7OX6

Family and domains

Sequence

MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIP
SDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGN
ALTFLKSLLEIFQKEKMRGMRGKI

Sequence length

144

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction JAK-STAT signaling pathway Asthma		Interleukin-9 signaling

IL9 (interleukin 9)