Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3575
Gene name	Interleukin 7 receptor
Gene symbol	IL7R
Synonyms (NCBI Gene)	CD127CDW127IL-7R-alphaIL-7RalphaIL7RAIL7RalphaILRAIMD104lnc-IL7RsIL-7R
Chromosome	5
Chromosome location	5p13.2
Summary	The protein encoded by this gene is a receptor for interleukin 7 (IL7). The function of this receptor requires the interleukin 2 receptor, gamma chain (IL2RG), which is a common gamma chain shared by the receptors of various cytokines, including interleuk

Show/Hide all (28)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893893	G>A	Pathogenic	Intron variant, coding sequence variant, stop gained
rs104893894	C>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs141698985	C>T	Likely-pathogenic	Stop gained, coding sequence variant, non coding transcript variant
rs147153824	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, intron variant, missense variant
rs193922640	->ATATATTTCA	Likely-pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant
rs193922641	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs193922642	A>C,G	Likely-pathogenic	Intron variant, missense variant, coding sequence variant
rs193922643	CG>TA	Likely-pathogenic	Intron variant, coding sequence variant, stop gained
rs193922645	G>T	Likely-pathogenic	Intron variant, missense variant, coding sequence variant
rs193922647	A>C	Likely-pathogenic	Stop lost, coding sequence variant, missense variant, non coding transcript variant, terminator codon variant
rs199641706	T>A,C	Pathogenic	Synonymous variant, coding sequence variant, non coding transcript variant
rs587778405	G>T	Not-provided, uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant, intron variant
rs757797163	G>C,T	Likely-pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs766399441	T>-	Pathogenic	Coding sequence variant, frameshift variant, non coding transcript variant
rs766555082	C>G,T	Pathogenic	Intron variant, coding sequence variant, stop gained, missense variant
rs777878144	G>A	Pathogenic	Splice donor variant
rs786205572	T>G	Likely-pathogenic	Coding sequence variant, intron variant, stop gained
rs786205646	T>-	Likely-pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant, 3 prime UTR variant
rs869312857	->A	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs1057519759	A>T	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs1315265916	G>A	Pathogenic	Splice acceptor variant, intron variant
rs1390410878	C>A	Pathogenic	Intron variant, coding sequence variant, stop gained
rs1448018291	A>C,T	Pathogenic	Coding sequence variant, missense variant, stop gained, non coding transcript variant
rs1554066684	GAAA>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs1554067182	->C	Pathogenic	Coding sequence variant, intron variant, frameshift variant
rs1561421608	AA>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs1561423197	TT>-	Pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs1561424886	A>G	Pathogenic	Intron variant, splice acceptor variant

Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029787	hsa-miR-26b-5p	Microarray	19088304
MIRT723842	hsa-miR-942-3p	HITS-CLIP	19536157
MIRT723841	hsa-miR-889-5p	HITS-CLIP	19536157
MIRT723840	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT723839	hsa-miR-6131	HITS-CLIP	19536157
MIRT723838	hsa-miR-3652	HITS-CLIP	19536157
MIRT723837	hsa-miR-4430	HITS-CLIP	19536157
MIRT723836	hsa-miR-4505	HITS-CLIP	19536157
MIRT723835	hsa-miR-5787	HITS-CLIP	19536157
MIRT723834	hsa-miR-3199	HITS-CLIP	19536157
MIRT723833	hsa-miR-8052	HITS-CLIP	19536157
MIRT723832	hsa-miR-365a-5p	HITS-CLIP	19536157
MIRT723831	hsa-miR-365b-5p	HITS-CLIP	19536157
MIRT723830	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT723829	hsa-miR-6842-3p	HITS-CLIP	19536157
MIRT723828	hsa-miR-4474-3p	HITS-CLIP	19536157
MIRT545078	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT545077	hsa-miR-190a-5p	PAR-CLIP	21572407
MIRT545076	hsa-miR-190b	PAR-CLIP	21572407
MIRT545075	hsa-miR-3682-3p	PAR-CLIP	21572407
MIRT545074	hsa-miR-4775	PAR-CLIP	21572407
MIRT545073	hsa-miR-3924	PAR-CLIP	21572407
MIRT723842	hsa-miR-942-3p	HITS-CLIP	19536157
MIRT723841	hsa-miR-889-5p	HITS-CLIP	19536157
MIRT723840	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT723839	hsa-miR-6131	HITS-CLIP	19536157
MIRT723838	hsa-miR-3652	HITS-CLIP	19536157
MIRT723837	hsa-miR-4430	HITS-CLIP	19536157
MIRT723836	hsa-miR-4505	HITS-CLIP	19536157
MIRT723835	hsa-miR-5787	HITS-CLIP	19536157
MIRT723834	hsa-miR-3199	HITS-CLIP	19536157
MIRT723833	hsa-miR-8052	HITS-CLIP	19536157
MIRT723832	hsa-miR-365a-5p	HITS-CLIP	19536157
MIRT723831	hsa-miR-365b-5p	HITS-CLIP	19536157
MIRT723830	hsa-miR-377-3p	HITS-CLIP	19536157
MIRT723829	hsa-miR-6842-3p	HITS-CLIP	19536157
MIRT723828	hsa-miR-4474-3p	HITS-CLIP	19536157
MIRT545078	hsa-miR-32-3p	PAR-CLIP	21572407
MIRT545077	hsa-miR-190a-5p	PAR-CLIP	21572407
MIRT545076	hsa-miR-190b	PAR-CLIP	21572407
MIRT545075	hsa-miR-3682-3p	PAR-CLIP	21572407
MIRT545074	hsa-miR-4775	PAR-CLIP	21572407
MIRT545073	hsa-miR-3924	PAR-CLIP	21572407
MIRT1065258	hsa-miR-600	CLIP-seq
MIRT1065259	hsa-miR-622	CLIP-seq
MIRT1065260	hsa-miR-629	CLIP-seq

Show/Hide all (50)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000018	Process	Regulation of DNA recombination	TAS	9495344
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001913	Process	T cell mediated cytotoxicity	IBA
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IEA
GO:0003823	Function	Antigen binding	TAS	9495344
GO:0004896	Function	Cytokine receptor activity	IDA	11418668, 20974963
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004917	Function	Interleukin-7 receptor activity	IBA
GO:0004917	Function	Interleukin-7 receptor activity	IDA	8128231
GO:0004917	Function	Interleukin-7 receptor activity	TAS	8266077
GO:0005515	Function	Protein binding	IPI	8266077, 19141282, 32296183, 35512704
GO:0005576	Component	Extracellular region	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	8128231
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	TAS	9843216
GO:0007165	Process	Signal transduction	TAS	2317865
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9843216
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	11418668
GO:0008361	Process	Regulation of cell size	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	11418668
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019725	Process	Cellular homeostasis	IDA	35021100
GO:0019725	Process	Cellular homeostasis	IDA	35021100
GO:0030097	Process	Hemopoiesis	IBA
GO:0030217	Process	T cell differentiation	IEA
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033089	Process	Positive regulation of T cell differentiation in thymus	IEA
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IBA
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IC	20974963
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IDA	8128231, 9182906, 20974963, 29202461
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IDA	8128231
GO:0042100	Process	B cell proliferation	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0046427	Process	Positive regulation of receptor signaling pathway via JAK-STAT	IBA
GO:0048535	Process	Lymph node development	IEA
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0070233	Process	Negative regulation of T cell apoptotic process	IEA
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IDA	11418668

MIM	HGNC	e!Ensembl
146661	6024	ENSG00000168685

P16871

Protein name

Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CDw127) (CD antigen CD127)

Protein function

Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).

PDB

3DI2 , 3DI3 , 3UP1 , 5J11 , 6P50 , 6P67 , 7OPB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18447	FN3_7	32 → 127	Fibronectin type III domain	Domain
PF00041	fn3	130 → 218	Fibronectin type III domain	Domain

Sequence

MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKK
IDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTH
VNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDP
ILLTISILSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESEKQRLGGDVQSPNCPSEDVVITPES
FGRDSSLTCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LQSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ

Sequence length

459

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction FoxO signaling pathway PI3K-Akt signaling pathway JAK-STAT signaling pathway Hematopoietic cell lineage Pathways in cancer Primary immunodeficiency		Interleukin-7 signaling Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis

545

Show/Hide Causal Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Breast neoplasm	Pathogenic	rs1717980926	RCV002285231
Histiocytic medullary reticulosis	Likely pathogenic	rs141698985	RCV000991308
IL7R-related disorder	Likely pathogenic	rs141698985	RCV003898007
Immunodeficiency 104	Pathogenic; Likely pathogenic	rs201559094, rs1354581284, rs1759969389, rs587778405, rs1759660930, rs1225034187, rs1759788196, rs1387689607, rs199641706, rs869312857, rs1369125529, rs200044623, rs2531575374, rs2531547862, rs202007062 View all (28 more)	RCV002032697 RCV001783479 RCV001843964 RCV000688209 RCV001941548 RCV001962844 RCV001998094 RCV002651894 RCV000416601 RCV000210421 RCV003626814 RCV000763140 RCV003515298 RCV003515583 RCV003516297 RCV003516298 RCV003516299 RCV003516300 RCV003515847 RCV003626927 RCV003627613 RCV003627055 RCV000015966 RCV000015967 RCV000015968 RCV000341907 RCV003842892 RCV003835374 RCV003991954 RCV003514302 RCV000820355 RCV002513253 RCV000535007 RCV000640050 RCV000685277 RCV000689926 RCV000701107 RCV001233554 RCV000796316 RCV000822917 RCV001869366 RCV001030043 RCV001219210
Multiple sclerosis, susceptibility to, 3	Pathogenic	rs869312857	RCV001336448
Severe combined immunodeficiency disease	Pathogenic; Likely pathogenic	rs587778405, rs869312857, rs1369125529, rs193922640, rs193922641, rs193922643, rs193922645, rs1561423197, rs1561424886, rs200076125	RCV003479011 RCV001844088 RCV003155650 RCV000030060 RCV000030061 RCV000030063 RCV000030065 RCV001731887 RCV000735986 RCV004768927
T-B+ severe combined immunodeficiency due to IL-7Ralpha deficiency	Pathogenic	rs201559094	RCV004017858

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
-	no classification for the single variant	rs1561418803, rs1002396899, rs757797163	-
Colon adenocarcinoma	Benign	rs201268331	RCV005907627
IMMUNODEFICIENCY 104, SEVERE COMBINED, SUSCEPTIBILITY TO	Uncertain significance	rs1759787978	RCV002260878
Multiple myeloma	Uncertain significance	rs1580851879	RCV000984126
Nonpapillary renal cell carcinoma	Uncertain significance	rs201084372	RCV005898996
Ovarian serous cystadenocarcinoma	Uncertain significance	rs758320927	RCV005912517
Sarcoma	Uncertain significance	rs758320927	RCV005912516
Thymoma	Conflicting classifications of pathogenicity	rs200373233	RCV005898995

Show/Hide Text Mining Associations (197)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Abortion Habitual	Associate	26345847
Acute Kidney Injury	Associate	39696008
Adenocarcinoma of Lung	Associate	23269987, 34301211, 34497605, 34580602, 34642306, 35710585, 38001428
Adrenocortical Carcinoma	Associate	34410225
Agammaglobulinemia	Inhibit	35611411
Alopecia Areata	Associate	20546884
Altitude Sickness	Inhibit	33393628
Aortic Aneurysm Abdominal	Stimulate	39586133
Arthralgia	Associate	33168080
Arthritis	Stimulate	19714586
Arthritis	Associate	33168080
Arthritis Juvenile	Associate	20072139
Arthritis Rheumatoid	Associate	19714586, 21129157, 21647866, 23280063, 25604867, 26314565, 30483789, 31131543, 32111105, 33168080, 33362761, 35015026, 36311761
Asthma	Associate	18581330, 19152963
Autoimmune Diseases	Associate	20072139, 28284938, 29456530, 31594933, 32231389, 35589883, 36734626
Autoimmune Diseases	Stimulate	28747257
Autoimmune Lymphoproliferative Syndrome	Associate	29686686
Bone Resorption	Associate	18479350
Brain Injuries Diffuse	Associate	36894313
Brain Neoplasms	Associate	37586773
Breast Neoplasms	Stimulate	30254632
Breast Neoplasms	Associate	37441083, 38087296
Bronchial Hyperreactivity	Associate	32032632
Bronchiolitis Obliterans Syndrome	Associate	25266000
Carcinoma Adenoid Cystic	Associate	22382400
Carcinoma Hepatocellular	Associate	12079511, 27821177, 32218692, 35243668, 36960063
Carcinoma Neuroendocrine	Associate	31852810
Carcinoma Non Small Cell Lung	Stimulate	19505916
Carcinoma Non Small Cell Lung	Associate	24695377, 31599032, 38057344
Carcinoma Ovarian Epithelial	Associate	14504049
Carcinoma Pancreatic Ductal	Associate	35793870
Carcinoma Renal Cell	Associate	19609102
Carcinoma Squamous Cell	Associate	33506299, 36438481
Carcinoma Transitional Cell	Associate	19623656
Cardiovascular Diseases	Associate	37166484
Celiac Disease	Associate	28283419, 31907928, 35682780
Cerebral Infarction	Associate	32746852, 36802116
Chagas Disease	Associate	30517089
Chickenpox	Associate	25046553
Cholangitis Sclerosing	Stimulate	28597951
Cleft Lip	Associate	25139022
Cognitive Dysfunction	Associate	37581646
Coinfection	Associate	27091211
Colitis	Associate	37114052
Colitis Ulcerative	Associate	24911414, 26333292, 37055495
Colorectal Neoplasms	Stimulate	34573368
Colorectal Neoplasms	Associate	34573368
Communication Disorders	Associate	35907923
Coronary Aneurysm	Associate	24419807
Coronary Artery Disease	Associate	30123216
COVID 19	Associate	32950268, 33578018
COVID 19	Inhibit	34080738
Crohn Disease	Associate	34615883, 36960063
Cytomegalovirus Infections	Associate	19685052, 19690616, 29456530
Cytomegalovirus Infections	Inhibit	28683106
Death	Associate	38251667
Dermatitis Atopic	Associate	33901562
Diabetes Mellitus	Associate	32894076
Diabetes Mellitus Insulin Dependent 19	Associate	32894076
Diabetes Mellitus Type 1	Associate	16818678, 18248531, 18563381, 24572742, 26714416, 28747257, 31110501, 31299986
Diabetes Mellitus Type 1	Inhibit	24348676, 34625948
Diabetes Mellitus Type 1	Stimulate	30723474
Diabetes Mellitus Type 2	Associate	38049854
Drug Hypersensitivity	Associate	19152963
Drug Related Side Effects and Adverse Reactions	Associate	20130059, 22661557, 31519862, 36960063, 39186002
Erectile Dysfunction	Associate	25343742
Failure to Thrive	Associate	31736942
Fatigue Syndrome Chronic	Inhibit	26881265
Fibrosis	Associate	26123260, 29742149
Gastritis Atrophic	Associate	35905420
Giant Cell Arteritis	Associate	39817309
Glucocorticoid Receptor Deficiency	Associate	35734930
Glucose Metabolism Disorders	Associate	34350463
Granuloma	Associate	32350353, 39373788
Graves Disease	Inhibit	27206624
Harlequin type ichthyosis	Inhibit	34614112
Hashimoto Disease	Associate	11045564
Hashimoto Disease	Inhibit	27206624
Heart Diseases	Associate	25769928, 27322554
Heart Failure	Associate	38065888
Hemihyperplasia Isolated	Stimulate	27910891
Hepatitis Autoimmune	Associate	28597951
Hepatitis B	Associate	21536738
Hepatitis C	Associate	27315061
Hepatitis C Chronic	Associate	26123260, 29742149
Hereditary leiomyomatosis and renal cell cancer	Associate	18684866
HIV Infections	Associate	15643013, 17005693, 19096522, 19459995, 19494261, 19690616, 21209878, 21778338, 24911414, 25033393, 26123260, 27377704, 28181541, 28746881, 29262860 View all (10 more)
HIV Infections	Inhibit	16421946, 16487237, 19239367, 19350559, 19864382, 20520721, 21740271, 21920046, 22310831, 23965471
Hodgkin Disease	Associate	21904560
Hypertension Pulmonary	Associate	20973920
Hypoxia	Associate	25329529
Immune System Diseases	Associate	9005984
Immunologic Deficiency Syndromes	Associate	30483789, 31379863
Infections	Associate	11568004, 17005693, 25329529, 34226281, 38251667
Infections	Inhibit	21740271
Infectious Mononucleosis	Inhibit	16543467
Infectious Mononucleosis	Associate	19605492
Inflammation	Associate	18581330, 19152963, 21129157, 27240835, 27821506, 27910891, 28284938, 29504848, 33578018, 34580602, 35015026, 36734626, 37586773
Inflammation	Inhibit	19216740
Inflammatory Bowel Diseases	Associate	21376048, 24911414, 31618209
Leishmaniasis Cutaneous	Associate	25139022
Leukemia	Associate	15651075, 21046101, 21536738, 30185437, 32118299, 36599086, 38251667
Leukemia B Cell	Associate	21536738
Leukemia Biphenotypic Acute	Associate	28557976
Leukemia Lymphocytic Chronic B Cell	Associate	12079511, 20952689
Leukemia Myeloid Acute	Associate	35874754, 39186002
Liver Cirrhosis	Associate	26123260, 29742149
Liver Cirrhosis Biliary	Associate	20638239, 23000144
Liver Diseases	Associate	26123260
Lung Diseases Interstitial	Inhibit	35589883
Lung Neoplasms	Associate	19505916, 22471460, 24678068, 24695377, 34440780
Lupus Erythematosus Systemic	Associate	18576316, 19155519, 22661557, 23264357, 27156107
Lupus Erythematosus Systemic	Stimulate	28747257
Lupus Nephritis	Associate	23264357
Lymphatic Metastasis	Associate	23826668, 37169342
Lymphoma	Associate	11045564
Lymphoma B Cell	Associate	20952689, 22174855
Lymphoma Follicular	Associate	20952689, 34226281
Lymphoma Large B Cell Diffuse	Associate	35069971, 40302006
Lymphoma Non Hodgkin	Associate	20952689
Lymphoma T Cell	Associate	24572742, 27470599, 34867966
Lymphopenia	Associate	19690616
Lymphopenia	Inhibit	21209878
Lymphopenic Hypergammaglobulinemia Antibody Deficiency Autoimmune Hemolytic Anemia and Glomerulonephritis	Associate	17312174
Measles	Associate	17538120, 20201040
Melanoma	Associate	33820810, 34159752, 36202232
Melanoma Cutaneous Malignant	Associate	35300397, 35850640, 36032150
Mesothelioma Malignant	Associate	36054746
Mucositis	Associate	31907928
Multiple Sclerosis	Associate	18769633, 19221116, 19304328, 20112030, 21287555, 21300823, 23985573, 24130718, 24147013, 24572742, 24770783, 26608987, 26718593, 27424664, 28340352 View all (5 more)
Multiple Sclerosis	Stimulate	26881265
Multiple Sclerosis Chronic Progressive	Associate	24770783
Multiple Sclerosis Relapsing Remitting	Associate	28865414
Myasthenia Gravis	Associate	23110942, 30734484
Mycosis Fungoides	Associate	34583709
Myelodysplastic Syndromes	Associate	15147372
Myositis Inclusion Body	Associate	24594700
Nasal Polyps	Inhibit	28474861
Neoplasm Metastasis	Associate	34159752
Neoplasm Metastasis	Inhibit	40725191
Neoplasms	Associate	19685052, 20201040, 22319577, 22735807, 23269987, 27821177, 31881847, 32605588, 32812852, 34159752, 34410225, 35660746, 35850640, 35874754, 36438481, 39186002 View all (1 more)
Neoplasms	Stimulate	23826668
Neoplasms Squamous Cell	Associate	20110382
Nephrotic Syndrome	Associate	27997540, 35734930
Neuromyelitis Optica	Associate	26608987
Obesity Morbid	Associate	37266430
Opportunistic Infections	Associate	31736942
Osteoarthritis	Associate	30483789
Osteoarthritis Knee	Associate	35016442
Osteoporosis	Associate	37318459
Otitis Media with Effusion	Associate	22382400
Ovarian Neoplasms	Associate	14504049, 35186171
Pancreatic Neoplasms	Associate	37381714
Papilloma	Associate	22322668
Pediatric Obesity	Associate	30809229
Porphyria Acute Intermittent	Associate	31018952
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	15651075, 24678068
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	1650261, 21536738, 24374627, 27322554, 27997540, 28408464, 35874754, 36599086
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Inhibit	20459861
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22237106, 24678068, 27322685, 27470599, 31270080, 32479694, 34139642, 35734930, 37023368
Prostatic Neoplasms Castration Resistant	Associate	23319273
Pulmonary Disease Chronic Obstructive	Associate	21651772, 24430176, 36655999
Pulmonary edema of mountaineers	Associate	33393628
Purpura Thrombocytopenic Idiopathic	Associate	28466476
Renal Insufficiency	Inhibit	26627102
Renal Insufficiency	Associate	27191978
Respiratory Tract Diseases	Associate	25329529
Rubella	Associate	25046553
Sarcoidosis	Associate	22984568
Sarcopenia	Associate	34371826
Scleroderma Systemic	Associate	20973920, 35663995
Severe Combined Immunodeficiency	Associate	17827065, 21536738, 25046553, 27807805, 29551298, 31379863, 31736942, 33040328, 35418989, 36919728, 38082310, 38251667, 39352394
Sjogren's Syndrome	Associate	29504848, 36505431
Spondylitis Ankylosing	Associate	31594933
Spondylitis Ankylosing	Stimulate	39185422
Squamous Cell Carcinoma of Head and Neck	Associate	23826668
Status Asthmaticus	Associate	17951166, 32032632
Stomach Neoplasms	Associate	18687755, 36735714
T Lymphocytopenia Idiopathic CD4 Positive	Inhibit	22454463
T Lymphocytopenia Idiopathic CD4 Positive	Associate	25046553
Tachycardia Atrioventricular Nodal Reentry	Associate	23826668
Takayasu Arteritis	Associate	39817309
Tertiary Lymphoid Structures	Associate	17665400
Thrombocytopenia	Associate	31736942
Thymoma	Associate	30734484
Thyroid Neoplasms	Associate	32812852
Thyroiditis Autoimmune	Associate	27206624
Triple Negative Breast Neoplasms	Associate	37441083
Tuberculosis	Associate	24885723
Tuberculosis Meningeal	Associate	35710869
Uterine Cervical Neoplasms	Associate	23587428
Vasculitis	Associate	39817309
Viremia	Associate	32194543
Virus Diseases	Associate	19690616
Virus Diseases	Inhibit	20201040
Vitamin D Deficiency	Associate	32111053
X Linked Combined Immunodeficiency Diseases	Associate	17363735, 21625022, 21883749, 37581646, 39352394, 9005984, 9885222

IL7R (interleukin 7 receptor)