Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3572
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 6 cytokine family signal transducer
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL6ST
Synonyms (NCBI Gene) Gene synonyms aliases
CD130, CDW130, GP130, HIES4, HIES4A, HIES4B, IL-6RB, IMD94, STWS2, sGP130
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5q11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a signal transducer shared by many cytokines, including interleukin 6 (IL6), ciliary neurotrophic factor (CNTF), leukemia inhibitory factor (LIF), and oncostatin M (OSM). This protein functions as a part of the cytokine
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs1580801731 G>A Pathogenic Coding sequence variant, non coding transcript variant, missense variant, intron variant, 3 prime UTR variant
rs1580809257 T>A Pathogenic Missense variant, coding sequence variant, non coding transcript variant, 3 prime UTR variant
rs1580817729 G>A Pathogenic 5 prime UTR variant, stop gained, coding sequence variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016213 hsa-miR-590-3p Sequencing 20371350
MIRT017169 hsa-miR-335-5p Microarray 18185580
MIRT024434 hsa-miR-215-5p Microarray 19074876
MIRT026283 hsa-miR-192-5p Microarray 19074876
MIRT040397 hsa-miR-615-3p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002675 Process Positive regulation of acute inflammatory response IC 8999038
GO:0002821 Process Positive regulation of adaptive immune response IMP 14764690
GO:0004896 Function Cytokine receptor activity IBA
GO:0004896 Function Cytokine receptor activity IEA
GO:0004897 Function Ciliary neurotrophic factor receptor activity IDA 12643274
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
600694 6021 ENSG00000134352
Protein
UniProt ID P40189
Protein name Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (CDw130) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
Protein function Signal-transducing molecule (PubMed:2261637). The receptor systems for IL6, LIF, OSM, CNTF, IL11, CTF1 and BSF3 can utilize IL6ST for initiating signal transmission. Binding of IL6 to IL6R induces IL6ST homodimerization and formation of a high-a
PDB 1BJ8 , 1BQU , 1I1R , 1P9M , 1PVH , 3L5H , 3L5I , 3L5J , 7U7N , 8D6A , 8D74 , 8D7R , 8D82 , 8D85 , 8DPS , 8DPT , 8DPU , 8UPA , 8V29 , 8V2A
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06328 Lep_receptor_Ig 26 112 Ig-like C2-type domain Domain
PF09240 IL6Ra-bind 131 218 Interleukin-6 receptor alpha chain, binding Domain
PF00041 fn3 223 311 Fibronectin type III domain Domain
PF00041 fn3 518 605 Fibronectin type III domain Domain
Tissue specificity TISSUE SPECIFICITY: Found in all the tissues and cell lines examined (PubMed:2261637). Expression not restricted to IL6 responsive cells (PubMed:2261637). {ECO:0000269|PubMed:2261637}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in blood serum (at protein
Sequence
MLTLQTWLVQALFIFLTTESTGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLE
QNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVY
KVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIR
CMKEDGKGYWS
DWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHRT
YLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPE
FTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFNSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGGDGILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRLKQQISDHISQSCGSGQMKMFQEVSAADAFGPGTEGQVERFETVGMEAATDEG
MPKSYLPQTVRQGGYMPQ
Sequence length 918
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
Signaling pathways regulating pluripotency of stem cells
JAK-STAT signaling pathway
Th17 cell differentiation
Kaposi sarcoma-associated herpesvirus infection
Coronavirus disease - COVID-19
Pathways in cancer
Viral carcinogenesis
  Interleukin-6 signaling
MAPK3 (ERK1) activation
MAPK1 (ERK2) activation
IL-6-type cytokine receptor ligand interactions
Interleukin-35 Signalling
Interleukin-27 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hyper-IgE Syndrome Hyper-IgE recurrent infection syndrome 4, autosomal recessive rs1580801731, rs1580809257 N/A
Stuve-Wiedemann syndrome stuve-wiedemann syndrome, Stuve-Wiedemann syndrome 2 rs1580817729, rs1579734448 N/A
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 36003311
Adenoma Liver Cell Associate 19020503, 28323122
Adrenal Gland Neoplasms Associate 12917504
AIDS related Kaposi sarcoma Associate 7657807
Arthritis Rheumatoid Associate 20604932, 35140805
Asthma Associate 31945409, 33626956, 33691249
Atherosclerosis Inhibit 31932740
Atherosclerosis Associate 39216780
Autoimmune Diseases Associate 34149710
Behcet Syndrome Associate 35455984