Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3570
Gene name	Interleukin 6 receptor
Gene symbol	IL6R
Synonyms (NCBI Gene)	CD126HIES5IL-1RaIL-6RIL-6R-1IL-6RAIL6QIL6QTLIL6RAIL6RQgp80
Chromosome	1
Chromosome location	1q21.3
Summary	This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein comple

426

Show/Hide all (426)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005528	hsa-miR-23a-3p	GFP reporter assayMicroarrayqRT-PCRWestern blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assayMicroarrayqRT-PCRWestern blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assayMicroarrayqRT-PCRWestern blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assayMicroarrayqRT-PCRWestern blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assayMicroarrayqRT-PCRWestern blot	20698883
MIRT005528	hsa-miR-23a-3p	GFP reporter assayMicroarrayqRT-PCRWestern blot	20698883
MIRT006541	hsa-miR-124-3p	ELISAFlowImmunohistochemistryImmunoprecipitaionIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22153071
MIRT006541	hsa-miR-124-3p	ELISAFlowImmunohistochemistryImmunoprecipitaionIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22153071
MIRT006844	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	22942733
MIRT006844	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	22942733
MIRT027423	hsa-miR-98-5p	Microarray	19088304
MIRT006844	hsa-miR-125b-5p	Luciferase reporter assayWestern blot	22824797
MIRT054843	hsa-miR-451a	qRT-PCRWestern blot	24445140
MIRT438704	hsa-miR-34a-5p	ChIP-seqImmunofluorescenceqRT-PCRWestern blot	24642471
MIRT438703	hsa-miR-34b-3p	ChIP-seqImmunofluorescenceqRT-PCRWestern blot	24642471
MIRT438702	hsa-miR-34c-5p	ChIP-seqImmunofluorescenceqRT-PCRWestern blot	24642471
MIRT438704	hsa-miR-34a-5p	ChIP-seqImmunofluorescenceqRT-PCRWestern blot	24642471
MIRT438703	hsa-miR-34b-3p	ChIP-seqImmunofluorescenceqRT-PCRWestern blot	24642471
MIRT438702	hsa-miR-34c-5p	ChIP-seqImmunofluorescenceqRT-PCRWestern blot	24642471
MIRT714013	hsa-miR-548at-3p	HITS-CLIP	19536157
MIRT714012	hsa-miR-548ay-3p	HITS-CLIP	19536157
MIRT714011	hsa-miR-1537-3p	HITS-CLIP	19536157
MIRT054843	hsa-miR-451a	HITS-CLIP	19536157
MIRT714010	hsa-miR-5197-5p	HITS-CLIP	19536157
MIRT714009	hsa-miR-5680	HITS-CLIP	19536157
MIRT714008	hsa-miR-4330	HITS-CLIP	19536157
MIRT714007	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT714006	hsa-miR-2052	HITS-CLIP	19536157
MIRT714005	hsa-miR-7641	HITS-CLIP	19536157
MIRT687901	hsa-miR-4418	HITS-CLIP	23313552
MIRT687900	hsa-miR-509-3-5p	HITS-CLIP	23313552
MIRT687899	hsa-miR-509-5p	HITS-CLIP	23313552
MIRT687898	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT687897	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT687896	hsa-miR-1915-3p	HITS-CLIP	23313552
MIRT687895	hsa-miR-6764-5p	HITS-CLIP	23313552
MIRT687894	hsa-miR-4726-3p	HITS-CLIP	23313552
MIRT687893	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT687892	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT687891	hsa-miR-1307-3p	HITS-CLIP	23313552
MIRT687890	hsa-miR-4638-5p	HITS-CLIP	23313552
MIRT687889	hsa-miR-1184	HITS-CLIP	23313552
MIRT687888	hsa-miR-6790-3p	HITS-CLIP	23313552
MIRT687887	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT687886	hsa-miR-4284	HITS-CLIP	23313552
MIRT687885	hsa-miR-192-5p	HITS-CLIP	23313552
MIRT687884	hsa-miR-215-5p	HITS-CLIP	23313552
MIRT687883	hsa-miR-7156-3p	HITS-CLIP	23313552
MIRT646824	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT646823	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT646822	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT646821	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT646820	hsa-miR-5096	HITS-CLIP	23824327
MIRT646819	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT523017	hsa-miR-4438	PAR-CLIP	23446348
MIRT523016	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT523015	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT523014	hsa-miR-4722-3p	PAR-CLIP	23446348
MIRT523013	hsa-miR-6727-3p	PAR-CLIP	23446348
MIRT523012	hsa-miR-6747-3p	PAR-CLIP	23446348
MIRT523011	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT523010	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT523008	hsa-miR-5095	PAR-CLIP	23446348
MIRT523009	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT523007	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT523006	hsa-miR-3619-3p	PAR-CLIP	23446348
MIRT523005	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT054843	hsa-miR-451a	Luciferase reporter assay	25623956
MIRT732213	hsa-miR-221-5p	Luciferase reporter assayqRT-PCRWestern blot	26645045
MIRT732213	hsa-miR-221-5p	Luciferase reporter assayqRT-PCRWestern blot	26645045
MIRT732213	hsa-miR-221-5p	Luciferase reporter assayqRT-PCRWestern blot	26645045
MIRT732213	hsa-miR-221-5p	Luciferase reporter assayqRT-PCRWestern blot	26645045
MIRT438704	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	25973020
MIRT438704	hsa-miR-34a-5p	Luciferase reporter assay	26091352
MIRT438704	hsa-miR-34a-5p	Luciferase reporter assay	26091352
MIRT006541	hsa-miR-124-3p	ELISAFlowqRT-PCRWestern blot	27824145
MIRT027423	hsa-miR-98-5p	PAR-CLIP	27292025
MIRT438704	hsa-miR-34a-5p	Luciferase reporter assay	32391256
MIRT054843	hsa-miR-451a	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometryELISA	32989397
MIRT714013	hsa-miR-548at-3p	HITS-CLIP	19536157
MIRT714012	hsa-miR-548ay-3p	HITS-CLIP	19536157
MIRT714011	hsa-miR-1537-3p	HITS-CLIP	19536157
MIRT054843	hsa-miR-451a	HITS-CLIP	19536157
MIRT714010	hsa-miR-5197-5p	HITS-CLIP	19536157
MIRT714009	hsa-miR-5680	HITS-CLIP	19536157
MIRT714008	hsa-miR-4330	HITS-CLIP	19536157
MIRT714007	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT714006	hsa-miR-2052	HITS-CLIP	19536157
MIRT714005	hsa-miR-7641	HITS-CLIP	19536157
MIRT687901	hsa-miR-4418	HITS-CLIP	23313552
MIRT687900	hsa-miR-509-3-5p	HITS-CLIP	23313552
MIRT687899	hsa-miR-509-5p	HITS-CLIP	23313552
MIRT687898	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT687897	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT687896	hsa-miR-1915-3p	HITS-CLIP	23313552
MIRT687895	hsa-miR-6764-5p	HITS-CLIP	23313552
MIRT687894	hsa-miR-4726-3p	HITS-CLIP	23313552
MIRT687893	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT687892	hsa-miR-1304-3p	HITS-CLIP	23313552
MIRT687891	hsa-miR-1307-3p	HITS-CLIP	23313552
MIRT687890	hsa-miR-4638-5p	HITS-CLIP	23313552
MIRT687889	hsa-miR-1184	HITS-CLIP	23313552
MIRT687888	hsa-miR-6790-3p	HITS-CLIP	23313552
MIRT687887	hsa-miR-6821-3p	HITS-CLIP	23313552
MIRT687886	hsa-miR-4284	HITS-CLIP	23313552
MIRT687885	hsa-miR-192-5p	HITS-CLIP	23313552
MIRT687884	hsa-miR-215-5p	HITS-CLIP	23313552
MIRT687883	hsa-miR-7156-3p	HITS-CLIP	23313552
MIRT646824	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT646823	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT646822	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT646821	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT646820	hsa-miR-5096	HITS-CLIP	23824327
MIRT646819	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT523017	hsa-miR-4438	PAR-CLIP	23446348
MIRT523016	hsa-miR-6504-3p	PAR-CLIP	23446348
MIRT523015	hsa-miR-4793-5p	PAR-CLIP	23446348
MIRT523014	hsa-miR-4722-3p	PAR-CLIP	23446348
MIRT523013	hsa-miR-6727-3p	PAR-CLIP	23446348
MIRT523012	hsa-miR-6747-3p	PAR-CLIP	23446348
MIRT523011	hsa-miR-1292-3p	PAR-CLIP	23446348
MIRT523010	hsa-miR-4529-5p	PAR-CLIP	23446348
MIRT523008	hsa-miR-5095	PAR-CLIP	23446348
MIRT523009	hsa-miR-7151-3p	PAR-CLIP	23446348
MIRT523007	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT523006	hsa-miR-3619-3p	PAR-CLIP	23446348
MIRT523005	hsa-miR-619-5p	PAR-CLIP	23446348
MIRT1065000	hsa-let-7a	CLIP-seq
MIRT1065001	hsa-let-7b	CLIP-seq
MIRT1065002	hsa-let-7c	CLIP-seq
MIRT1065003	hsa-let-7d	CLIP-seq
MIRT1065004	hsa-let-7e	CLIP-seq
MIRT1065005	hsa-let-7f	CLIP-seq
MIRT1065006	hsa-let-7g	CLIP-seq
MIRT1065007	hsa-let-7i	CLIP-seq
MIRT1065008	hsa-miR-106a	CLIP-seq
MIRT1065009	hsa-miR-106b	CLIP-seq
MIRT1065010	hsa-miR-1183	CLIP-seq
MIRT1065011	hsa-miR-1200	CLIP-seq
MIRT1065012	hsa-miR-1207-5p	CLIP-seq
MIRT1065013	hsa-miR-122	CLIP-seq
MIRT1065014	hsa-miR-1224-3p	CLIP-seq
MIRT1065015	hsa-miR-1236	CLIP-seq
MIRT1065016	hsa-miR-1245	CLIP-seq
MIRT1065017	hsa-miR-125a-5p	CLIP-seq
MIRT1065018	hsa-miR-125b	CLIP-seq
MIRT1065019	hsa-miR-1260	CLIP-seq
MIRT1065020	hsa-miR-1260b	CLIP-seq
MIRT1065021	hsa-miR-1267	CLIP-seq
MIRT1065022	hsa-miR-1277	CLIP-seq
MIRT1065023	hsa-miR-1280	CLIP-seq
MIRT1065024	hsa-miR-1290	CLIP-seq
MIRT1065025	hsa-miR-1291	CLIP-seq
MIRT1065026	hsa-miR-1299	CLIP-seq
MIRT1065027	hsa-miR-1307	CLIP-seq
MIRT1065028	hsa-miR-136	CLIP-seq
MIRT1065029	hsa-miR-150	CLIP-seq
MIRT1065030	hsa-miR-17	CLIP-seq
MIRT1065031	hsa-miR-202	CLIP-seq
MIRT1065032	hsa-miR-2053	CLIP-seq
MIRT1065033	hsa-miR-20a	CLIP-seq
MIRT1065034	hsa-miR-20b	CLIP-seq
MIRT1065035	hsa-miR-214	CLIP-seq
MIRT1065036	hsa-miR-219-1-3p	CLIP-seq
MIRT1065037	hsa-miR-23a	CLIP-seq
MIRT1065038	hsa-miR-23b	CLIP-seq
MIRT1065039	hsa-miR-23c	CLIP-seq
MIRT1065040	hsa-miR-302a	CLIP-seq
MIRT1065041	hsa-miR-302b	CLIP-seq
MIRT1065042	hsa-miR-302c	CLIP-seq
MIRT1065043	hsa-miR-302d	CLIP-seq
MIRT1065044	hsa-miR-302e	CLIP-seq
MIRT1065045	hsa-miR-3126-3p	CLIP-seq
MIRT1065046	hsa-miR-3135b	CLIP-seq
MIRT1065047	hsa-miR-3144-5p	CLIP-seq
MIRT1065048	hsa-miR-3160-5p	CLIP-seq
MIRT1065049	hsa-miR-3167	CLIP-seq
MIRT1065050	hsa-miR-3191	CLIP-seq
MIRT1065051	hsa-miR-3194-3p	CLIP-seq
MIRT1065052	hsa-miR-323b-3p	CLIP-seq
MIRT1065053	hsa-miR-3619-5p	CLIP-seq
MIRT1065054	hsa-miR-3652	CLIP-seq
MIRT1065055	hsa-miR-3670	CLIP-seq
MIRT1065056	hsa-miR-3714	CLIP-seq
MIRT1065057	hsa-miR-371-5p	CLIP-seq
MIRT1065058	hsa-miR-371b-5p	CLIP-seq
MIRT1065059	hsa-miR-372	CLIP-seq
MIRT1065060	hsa-miR-373	CLIP-seq
MIRT1065061	hsa-miR-378	CLIP-seq
MIRT1065062	hsa-miR-378b	CLIP-seq
MIRT1065063	hsa-miR-378c	CLIP-seq
MIRT1065064	hsa-miR-378d	CLIP-seq
MIRT1065065	hsa-miR-378e	CLIP-seq
MIRT1065066	hsa-miR-378f	CLIP-seq
MIRT1065067	hsa-miR-378h	CLIP-seq
MIRT1065068	hsa-miR-378i	CLIP-seq
MIRT1065069	hsa-miR-3913-3p	CLIP-seq
MIRT1065070	hsa-miR-3922-5p	CLIP-seq
MIRT1065071	hsa-miR-3974	CLIP-seq
MIRT1065072	hsa-miR-422a	CLIP-seq
MIRT1065073	hsa-miR-4286	CLIP-seq
MIRT1065074	hsa-miR-4310	CLIP-seq
MIRT1065075	hsa-miR-4312	CLIP-seq
MIRT1065076	hsa-miR-4319	CLIP-seq
MIRT1065077	hsa-miR-4324	CLIP-seq
MIRT1065078	hsa-miR-4430	CLIP-seq
MIRT1065079	hsa-miR-4504	CLIP-seq
MIRT1065080	hsa-miR-4638-3p	CLIP-seq
MIRT1065081	hsa-miR-4652-3p	CLIP-seq
MIRT1065082	hsa-miR-4652-5p	CLIP-seq
MIRT1065083	hsa-miR-4667-5p	CLIP-seq
MIRT1065084	hsa-miR-4668-5p	CLIP-seq
MIRT1065085	hsa-miR-4691-5p	CLIP-seq
MIRT1065086	hsa-miR-4700-5p	CLIP-seq
MIRT1065087	hsa-miR-4731-5p	CLIP-seq
MIRT1065088	hsa-miR-4736	CLIP-seq
MIRT1065089	hsa-miR-4742-3p	CLIP-seq
MIRT1065090	hsa-miR-4757-5p	CLIP-seq
MIRT1065091	hsa-miR-4763-3p	CLIP-seq
MIRT1065092	hsa-miR-4778-5p	CLIP-seq
MIRT1065093	hsa-miR-4782-5p	CLIP-seq
MIRT1065094	hsa-miR-516b	CLIP-seq
MIRT1065095	hsa-miR-519d	CLIP-seq
MIRT1065096	hsa-miR-520a-3p	CLIP-seq
MIRT1065097	hsa-miR-520b	CLIP-seq
MIRT1065098	hsa-miR-520c-3p	CLIP-seq
MIRT1065099	hsa-miR-520d-3p	CLIP-seq
MIRT1065100	hsa-miR-520e	CLIP-seq
MIRT1065101	hsa-miR-520g	CLIP-seq
MIRT1065102	hsa-miR-520h	CLIP-seq
MIRT1065103	hsa-miR-532-3p	CLIP-seq
MIRT1065104	hsa-miR-542-3p	CLIP-seq
MIRT1065105	hsa-miR-544b	CLIP-seq
MIRT1065106	hsa-miR-548ad	CLIP-seq
MIRT1065107	hsa-miR-556-5p	CLIP-seq
MIRT1065108	hsa-miR-569	CLIP-seq
MIRT1065109	hsa-miR-570	CLIP-seq
MIRT1065110	hsa-miR-576-3p	CLIP-seq
MIRT1065111	hsa-miR-610	CLIP-seq
MIRT1065112	hsa-miR-653	CLIP-seq
MIRT1065113	hsa-miR-758	CLIP-seq
MIRT1065114	hsa-miR-761	CLIP-seq
MIRT1065115	hsa-miR-876-5p	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq
MIRT1065117	hsa-miR-93	CLIP-seq
MIRT1065118	hsa-miR-98	CLIP-seq
MIRT1550133	hsa-miR-4433	CLIP-seq
MIRT2015487	hsa-miR-1273d	CLIP-seq
MIRT2015488	hsa-miR-1285	CLIP-seq
MIRT2015489	hsa-miR-1321	CLIP-seq
MIRT2015490	hsa-miR-149	CLIP-seq
MIRT1065036	hsa-miR-219-1-3p	CLIP-seq
MIRT1065037	hsa-miR-23a	CLIP-seq
MIRT1065038	hsa-miR-23b	CLIP-seq
MIRT1065039	hsa-miR-23c	CLIP-seq
MIRT2015491	hsa-miR-3064-5p	CLIP-seq
MIRT2015492	hsa-miR-3120-5p	CLIP-seq
MIRT2015493	hsa-miR-3158-5p	CLIP-seq
MIRT2015494	hsa-miR-3187-5p	CLIP-seq
MIRT2015495	hsa-miR-34a	CLIP-seq
MIRT2015496	hsa-miR-3945	CLIP-seq
MIRT2015497	hsa-miR-3978	CLIP-seq
MIRT2015498	hsa-miR-4253	CLIP-seq
MIRT1065077	hsa-miR-4324	CLIP-seq
MIRT2015499	hsa-miR-4446-5p	CLIP-seq
MIRT2015500	hsa-miR-4464	CLIP-seq
MIRT2015501	hsa-miR-449a	CLIP-seq
MIRT2015502	hsa-miR-449b	CLIP-seq
MIRT2015503	hsa-miR-4694-3p	CLIP-seq
MIRT2015504	hsa-miR-4739	CLIP-seq
MIRT2015505	hsa-miR-4748	CLIP-seq
MIRT2015506	hsa-miR-4755-5p	CLIP-seq
MIRT2015507	hsa-miR-4756-5p	CLIP-seq
MIRT2015508	hsa-miR-4794	CLIP-seq
MIRT2015509	hsa-miR-522	CLIP-seq
MIRT1065109	hsa-miR-570	CLIP-seq
MIRT2015510	hsa-miR-593	CLIP-seq
MIRT2015511	hsa-miR-612	CLIP-seq
MIRT2015512	hsa-miR-642b	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq
MIRT1065011	hsa-miR-1200	CLIP-seq
MIRT2247764	hsa-miR-1207-3p	CLIP-seq
MIRT1065014	hsa-miR-1224-3p	CLIP-seq
MIRT1065016	hsa-miR-1245	CLIP-seq
MIRT1065017	hsa-miR-125a-5p	CLIP-seq
MIRT1065018	hsa-miR-125b	CLIP-seq
MIRT1065019	hsa-miR-1260	CLIP-seq
MIRT1065020	hsa-miR-1260b	CLIP-seq
MIRT2247765	hsa-miR-1270	CLIP-seq
MIRT2015487	hsa-miR-1273d	CLIP-seq
MIRT2247766	hsa-miR-128	CLIP-seq
MIRT1065023	hsa-miR-1280	CLIP-seq
MIRT1065024	hsa-miR-1290	CLIP-seq
MIRT1065025	hsa-miR-1291	CLIP-seq
MIRT2247767	hsa-miR-132	CLIP-seq
MIRT1065028	hsa-miR-136	CLIP-seq
MIRT2247768	hsa-miR-142-5p	CLIP-seq
MIRT1065029	hsa-miR-150	CLIP-seq
MIRT2247769	hsa-miR-182	CLIP-seq
MIRT2247770	hsa-miR-186	CLIP-seq
MIRT2247771	hsa-miR-1913	CLIP-seq
MIRT2247772	hsa-miR-1915	CLIP-seq
MIRT2247773	hsa-miR-192	CLIP-seq
MIRT2247774	hsa-miR-1976	CLIP-seq
MIRT2247775	hsa-miR-212	CLIP-seq
MIRT1065035	hsa-miR-214	CLIP-seq
MIRT2247776	hsa-miR-215	CLIP-seq
MIRT1065036	hsa-miR-219-1-3p	CLIP-seq
MIRT2247777	hsa-miR-22	CLIP-seq
MIRT1065037	hsa-miR-23a	CLIP-seq
MIRT1065038	hsa-miR-23b	CLIP-seq
MIRT1065039	hsa-miR-23c	CLIP-seq
MIRT2247778	hsa-miR-27a	CLIP-seq
MIRT2247779	hsa-miR-27b	CLIP-seq
MIRT2247780	hsa-miR-299-3p	CLIP-seq
MIRT2247781	hsa-miR-3121-5p	CLIP-seq
MIRT2247782	hsa-miR-3133	CLIP-seq
MIRT2247783	hsa-miR-3135	CLIP-seq
MIRT2247784	hsa-miR-3136-3p	CLIP-seq
MIRT2247785	hsa-miR-3152-5p	CLIP-seq
MIRT2247786	hsa-miR-3155	CLIP-seq
MIRT2247787	hsa-miR-3155b	CLIP-seq
MIRT2015493	hsa-miR-3158-5p	CLIP-seq
MIRT1065048	hsa-miR-3160-5p	CLIP-seq
MIRT1065049	hsa-miR-3167	CLIP-seq
MIRT2247788	hsa-miR-3189-5p	CLIP-seq
MIRT2247789	hsa-miR-320a	CLIP-seq
MIRT2247790	hsa-miR-320b	CLIP-seq
MIRT2247791	hsa-miR-320c	CLIP-seq
MIRT2247792	hsa-miR-320d	CLIP-seq
MIRT2247793	hsa-miR-320e	CLIP-seq
MIRT2247794	hsa-miR-323-3p	CLIP-seq
MIRT2247795	hsa-miR-324-3p	CLIP-seq
MIRT2247796	hsa-miR-330-3p	CLIP-seq
MIRT2247797	hsa-miR-335	CLIP-seq
MIRT2247798	hsa-miR-338-3p	CLIP-seq
MIRT2247799	hsa-miR-340	CLIP-seq
MIRT2015495	hsa-miR-34a	CLIP-seq
MIRT2247800	hsa-miR-3591-3p	CLIP-seq
MIRT2247801	hsa-miR-3617	CLIP-seq
MIRT1065053	hsa-miR-3619-5p	CLIP-seq
MIRT1065055	hsa-miR-3670	CLIP-seq
MIRT2247802	hsa-miR-3677-5p	CLIP-seq
MIRT1065069	hsa-miR-3913-3p	CLIP-seq
MIRT2247803	hsa-miR-3943	CLIP-seq
MIRT2247804	hsa-miR-4291	CLIP-seq
MIRT1065076	hsa-miR-4319	CLIP-seq
MIRT1065077	hsa-miR-4324	CLIP-seq
MIRT2247805	hsa-miR-4423-5p	CLIP-seq
MIRT2247806	hsa-miR-4429	CLIP-seq
MIRT2015501	hsa-miR-449a	CLIP-seq
MIRT2015502	hsa-miR-449b	CLIP-seq
MIRT2247807	hsa-miR-4531	CLIP-seq
MIRT2247808	hsa-miR-4646-5p	CLIP-seq
MIRT2247809	hsa-miR-4659a-3p	CLIP-seq
MIRT2247810	hsa-miR-4659b-3p	CLIP-seq
MIRT2247811	hsa-miR-4683	CLIP-seq
MIRT2247812	hsa-miR-4690-3p	CLIP-seq
MIRT2247813	hsa-miR-4725-5p	CLIP-seq
MIRT2247814	hsa-miR-4727-5p	CLIP-seq
MIRT2247815	hsa-miR-4729	CLIP-seq
MIRT1065089	hsa-miR-4742-3p	CLIP-seq
MIRT2247816	hsa-miR-4747-5p	CLIP-seq
MIRT1065090	hsa-miR-4757-5p	CLIP-seq
MIRT2247817	hsa-miR-4758-3p	CLIP-seq
MIRT1065093	hsa-miR-4782-5p	CLIP-seq
MIRT2247818	hsa-miR-484	CLIP-seq
MIRT2247819	hsa-miR-504	CLIP-seq
MIRT2247820	hsa-miR-513a-5p	CLIP-seq
MIRT2247821	hsa-miR-513c	CLIP-seq
MIRT2247822	hsa-miR-514b-5p	CLIP-seq
MIRT1065103	hsa-miR-532-3p	CLIP-seq
MIRT2247823	hsa-miR-543	CLIP-seq
MIRT1065106	hsa-miR-548ad	CLIP-seq
MIRT2247824	hsa-miR-553	CLIP-seq
MIRT2247825	hsa-miR-555	CLIP-seq
MIRT1065109	hsa-miR-570	CLIP-seq
MIRT2247826	hsa-miR-572	CLIP-seq
MIRT1065110	hsa-miR-576-3p	CLIP-seq
MIRT2247827	hsa-miR-579	CLIP-seq
MIRT2247828	hsa-miR-620	CLIP-seq
MIRT2247829	hsa-miR-621	CLIP-seq
MIRT2247830	hsa-miR-641	CLIP-seq
MIRT2247831	hsa-miR-646	CLIP-seq
MIRT2247832	hsa-miR-663b	CLIP-seq
MIRT2247833	hsa-miR-7	CLIP-seq
MIRT1065114	hsa-miR-761	CLIP-seq
MIRT1065115	hsa-miR-876-5p	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq
MIRT2247834	hsa-miR-922	CLIP-seq
MIRT2247803	hsa-miR-3943	CLIP-seq
MIRT2247812	hsa-miR-4690-3p	CLIP-seq
MIRT2247781	hsa-miR-3121-5p	CLIP-seq
MIRT2247788	hsa-miR-3189-5p	CLIP-seq
MIRT1065069	hsa-miR-3913-3p	CLIP-seq
MIRT2247813	hsa-miR-4725-5p	CLIP-seq
MIRT2247817	hsa-miR-4758-3p	CLIP-seq
MIRT2247819	hsa-miR-504	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq
MIRT2451784	hsa-miR-10a	CLIP-seq
MIRT2451785	hsa-miR-10b	CLIP-seq
MIRT2451786	hsa-miR-1283	CLIP-seq
MIRT2451787	hsa-miR-339-5p	CLIP-seq
MIRT2451788	hsa-miR-4421	CLIP-seq
MIRT2451789	hsa-miR-4684-5p	CLIP-seq
MIRT2015510	hsa-miR-593	CLIP-seq
MIRT1065013	hsa-miR-122	CLIP-seq
MIRT1065024	hsa-miR-1290	CLIP-seq
MIRT1065027	hsa-miR-1307	CLIP-seq
MIRT1065037	hsa-miR-23a	CLIP-seq
MIRT1065038	hsa-miR-23b	CLIP-seq
MIRT1065039	hsa-miR-23c	CLIP-seq
MIRT1065046	hsa-miR-3135b	CLIP-seq
MIRT1065049	hsa-miR-3167	CLIP-seq
MIRT1065054	hsa-miR-3652	CLIP-seq
MIRT1065078	hsa-miR-4430	CLIP-seq
MIRT1065093	hsa-miR-4782-5p	CLIP-seq
MIRT2247826	hsa-miR-572	CLIP-seq
MIRT2247829	hsa-miR-621	CLIP-seq
MIRT1065115	hsa-miR-876-5p	CLIP-seq
MIRT2247780	hsa-miR-299-3p	CLIP-seq
MIRT2247800	hsa-miR-3591-3p	CLIP-seq
MIRT2247825	hsa-miR-555	CLIP-seq
MIRT2682802	hsa-miR-656	CLIP-seq
MIRT2682803	hsa-miR-889	CLIP-seq
MIRT1065116	hsa-miR-9	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PPARA	Repression	14764586

Show/Hide all (71)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002384	Process	Hepatic immune response	TAS	12832423
GO:0002446	Process	Neutrophil mediated immunity	TAS	16034137
GO:0002548	Process	Monocyte chemotaxis	IC	10510402
GO:0002690	Process	Positive regulation of leukocyte chemotaxis	TAS	15100312, 16034137
GO:0004896	Function	Cytokine receptor activity	IDA	12829785
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004897	Function	Ciliary neurotrophic factor receptor activity	IMP	12643274
GO:0004915	Function	Interleukin-6 receptor activity	IDA	2261637
GO:0004915	Function	Interleukin-6 receptor activity	IEA
GO:0004921	Function	Interleukin-11 receptor activity	IBA
GO:0005138	Function	Interleukin-6 receptor binding	IPI	12829785
GO:0005515	Function	Protein binding	IPI	8702737, 11238858, 12829785, 16034137, 18775332, 25009770, 28265003, 32296183
GO:0005576	Component	Extracellular region	IDA	12748171
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	21990364
GO:0005615	Component	Extracellular space	IDA	12419823, 15579373, 16034137
GO:0005886	Component	Plasma membrane	IDA	12829785
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005896	Component	Interleukin-6 receptor complex	IDA	2261637, 12829785
GO:0005896	Component	Interleukin-6 receptor complex	IEA
GO:0006953	Process	Acute-phase response	TAS	12832423
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	2261637
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	18719127
GO:0009897	Component	External side of plasma membrane	IBA
GO:0010573	Process	Vascular endothelial growth factor production	IDA	12794819
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	16034137
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	2261637
GO:0019899	Function	Enzyme binding	IPI	12748171
GO:0019970	Function	Interleukin-11 binding	IBA
GO:0019981	Function	Interleukin-6 binding	IBA
GO:0019981	Function	Interleukin-6 binding	IEA
GO:0019981	Function	Interleukin-6 binding	IPI	12829785
GO:0031018	Process	Endocrine pancreas development	IC	18719127
GO:0031018	Process	Endocrine pancreas development	IMP	18719127
GO:0032502	Process	Developmental process	IEA
GO:0032717	Process	Negative regulation of interleukin-8 production	NAS	16034137
GO:0032722	Process	Positive regulation of chemokine production	IDA	10510402
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	10510402
GO:0032966	Process	Negative regulation of collagen biosynthetic process	IDA	12419823
GO:0034097	Process	Response to cytokine	IDA	2261637
GO:0038154	Process	Interleukin-11-mediated signaling pathway	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	12633863
GO:0043235	Component	Receptor complex	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	12419823
GO:0045669	Process	Positive regulation of osteoblast differentiation	TAS	12372336
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IDA	10510402
GO:0050829	Process	Defense response to Gram-negative bacterium	TAS	16034137
GO:0050830	Process	Defense response to Gram-positive bacterium	NAS	16034137
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IBA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	8272873, 12829785
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	11884403, 12829785, 31145836
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IEA
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	12643274
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS	27893700
GO:0070102	Process	Interleukin-6-mediated signaling pathway	ISS	27893700
GO:0070110	Component	Ciliary neurotrophic factor receptor complex	IDA	12643274
GO:0070119	Function	Ciliary neurotrophic factor binding	IPI	12643274
GO:0070120	Process	Ciliary neurotrophic factor-mediated signaling pathway	IMP	12643274
GO:0072126	Process	Positive regulation of glomerular mesangial cell proliferation	IMP	26563755
GO:0072540	Process	T-helper 17 cell lineage commitment	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS	27893700
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0097191	Process	Extrinsic apoptotic signaling pathway	TAS	15100312
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IMP	12643274
GO:1901731	Process	Positive regulation of platelet aggregation	IDA	31145836

MIM	HGNC	e!Ensembl
147880	6019	ENSG00000160712

P08887

Protein name

Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126) [Cleaved into: Soluble interleukin-6 receptor subunit alpha (sIL6R)]

Protein function

Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal (PubMed:28265003). Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-

PDB

1N26 , 1P9M , 2ARW , 5FUC , 7DC8 , 8D82 , 8IOW , 8QY5 , 8QY6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00047	ig	30 → 101	Immunoglobulin domain	Domain
PF09240	IL6Ra-bind	118 → 213	Interleukin-6 receptor alpha chain, binding	Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 2]: Expressed in peripheral blood mononuclear cells and weakly found in urine and serum. 1%-20% of the total sIL6R in plasma is generated by alternative splicing (PubMed:28060820). {ECO:0000269|PubMed:28060820}.

Sequence

MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR

Sequence length

468

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor HIF-1 signaling pathway PI3K-Akt signaling pathway JAK-STAT signaling pathway Hematopoietic cell lineage Th17 cell differentiation Non-alcoholic fatty liver disease Human cytomegalovirus infection Coronavirus disease - COVID-19 Pathways in cancer		Interleukin-6 signaling MAPK3 (ERK1) activation MAPK1 (ERK2) activation Interleukin-4 and Interleukin-13 signaling

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Benign	rs114283925	RCV005914175
Cervical cancer	Benign	rs114283925	RCV005914176
Familial cancer of breast	Benign	rs748952018	RCV005868620
Gastric cancer	Benign	rs748952018	RCV005868623
Hepatocellular carcinoma	Benign	rs4845374	RCV005914042
Hyper-IgE recurrent infection syndrome 5, autosomal recessive	Uncertain significance; no classifications from unflagged records	rs148682883, rs757025871, rs1163365013, rs2525458035, rs200103743, rs1689501445, rs1689606931	RCV001353358 RCV002243472 RCV003483910 RCV004577294 RCV004585157 RCV001250128 RCV001250129
IL6R-related disorder	Likely benign; Benign; Uncertain significance	rs28730735, rs528464156, rs2228144, rs371236018, rs576503217, rs370440294, rs368900229, rs764951367, rs201949342, rs894754581, rs538533109, rs71586015, rs2228145, rs768524019, rs2525467614, rs2228147, rs34099703 View all (2 more)	RCV004758177 RCV003921076 RCV003956126 RCV003911152 RCV003978747 RCV003978536 RCV003933511 RCV003943774 RCV003963687 RCV004758237 RCV003903783 RCV003980964 RCV003974830 RCV003948959 RCV003929727 RCV003963976 RCV003905895 RCV004758069
Interleukin 6, serum level of, quantitative trait locus	Benign	rs2228145	RCV000029243
Lung cancer	Benign	rs114283925	RCV005914180
Malignant lymphoma, large B-cell, diffuse	Benign	rs4845374, rs748952018	RCV005914045 RCV005868622
Melanoma	Likely benign	rs143961356	RCV005931367
Nonpapillary renal cell carcinoma	Benign	rs4845374, rs748952018	RCV005914043 RCV005868621
Ovarian cancer	Benign	rs4845374	RCV005914044
Ovarian serous cystadenocarcinoma	Benign	rs114283925	RCV005914178
Sarcoma	Benign	rs114283925	RCV005914177
Soluble interleukin-6 receptor, serum level of, quantitative trait locus	Benign	rs2228145	RCV000015767
Uterine carcinosarcoma	Benign	rs114283925	RCV005914179
Uterine corpus endometrial carcinoma	Benign; Uncertain significance	rs114283925, rs774739787, rs748952018	RCV005914181 RCV005923894 RCV005868624

Show/Hide Text Mining Associations (179)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	26626881
Acidemia isovaleric	Associate	33166496
Acquired Immunodeficiency Syndrome	Associate	1693429
Aggressive Periodontitis	Associate	28883894
Alzheimer Disease	Associate	26626881, 28650998, 36810164
Amyotrophic Lateral Sclerosis	Associate	31118040, 31611269, 34075589
Anhedonia	Associate	37932834
Anovulation	Associate	40287692
Anxiety	Associate	32769481
Aortic Aneurysm	Associate	30090940
Aortic Aneurysm Abdominal	Associate	23593036, 29507647, 37893562, 40008516
Aortic Aneurysm Thoracic	Associate	29158612
Appendicitis	Associate	26714766
Arthritis	Associate	28276471
Arthritis Juvenile	Associate	32730263
Arthritis Rheumatoid	Associate	11208277, 23379428, 23593036, 24668548, 24791950, 25016825, 25345743, 25888920, 26336855, 28659662, 30518408, 31483954, 33054050, 34931349, 37796367, 38001504 View all (1 more)
Ascites	Associate	27825119
Asthma	Associate	19503017, 21907864, 22554704, 23593036, 23945879, 24668548, 24791950, 25390970, 31101830, 38302925
Asthma Chronic Obstructive Pulmonary Disease Overlap Syndrome	Associate	38302925
Atherosclerosis	Associate	21835044, 38104193, 39216780
Atrial Fibrillation	Associate	21846873, 23593036, 24239840, 24940886, 30203815, 34931349, 35292824, 36253349
Atrial Fibrillation	Inhibit	37581400
Autoimmune Diseases	Associate	18490707, 25345743, 33590853, 34506050
Brain Injuries Traumatic	Associate	40710309
Breast Neoplasms	Associate	24670917, 27460086, 31795965, 36922677
Burkitt Lymphoma	Associate	9163607
Carcinogenesis	Stimulate	29258522
Carcinoma Hepatocellular	Associate	16425355, 22942733, 24668548, 32792856, 34053234
Carcinoma Non Small Cell Lung	Associate	31891569, 38184887
Carcinoma Ovarian Epithelial	Associate	27825119
Carcinoma Renal Cell	Associate	18384626, 26554658, 9462266
Carcinoma Renal Cell	Stimulate	8263017
Cardiovascular Diseases	Associate	30090940, 31707836, 32769481, 34931349, 35948913, 36441964, 39271913
Carotid Stenosis	Associate	21393601, 33350884
Castleman Disease	Associate	23372742, 34431136
Cataract	Associate	37694725
CD59 Deficiency	Associate	31276585
Cerebral Hemorrhage	Associate	30836997
Cerebral Infarction	Associate	26955245, 34931349
Cerebrovascular Disorders	Associate	33350884
Cholangiocarcinoma	Associate	30419338
Clear cell metastatic renal cell carcinoma	Associate	29665322
Cognition Disorders	Associate	26284520
Colonic Neoplasms	Associate	26673628
Colorectal Neoplasms	Stimulate	22674296
Colorectal Neoplasms	Associate	29068474, 31668584, 34931923
Coronary Artery Disease	Associate	24699044, 34931349, 35452290, 35604899, 40649979
Coronary Disease	Associate	19567438, 23593036, 24791950, 25781951, 30090940, 39271913
COVID 19	Associate	32783921, 33214204, 33590853, 34353696, 34731090, 34931923, 35064006, 35521908, 35989496, 37243282, 38165854, 39987891
COVID 19	Stimulate	33284859
Craniopharyngioma	Associate	28487953, 28859336
Crohn Disease	Associate	24668548, 24971461
Cytokine Release Syndrome	Associate	35040554, 35064006, 38165854
Death	Associate	36441964
Dermatitis Atopic	Associate	33901562
Diabetes Mellitus	Associate	18852330, 31864032, 38241313
Diabetes Mellitus Type 1	Associate	23593036, 24791950, 27629486
Diabetes Mellitus Type 2	Stimulate	19633828, 22761857
Diabetes Mellitus Type 2	Associate	31237452
Diabetic Nephropathies	Associate	26563755
Dissection Thoracic Aorta	Stimulate	38420822
Drug Related Side Effects and Adverse Reactions	Associate	32028672, 38565387
Dry Eye Syndromes	Associate	22128229
Dyslipidemias	Associate	21835044, 38001504
Endometriosis	Associate	28779573
Epstein Barr Virus Infections	Associate	32273550
Epstein Barr Virus Infections	Stimulate	9163607
Fallopian Tube Diseases	Associate	12496205
Fuchs' Endothelial Dystrophy	Stimulate	32636303
Gastritis	Associate	30105789
GATA2 Deficiency	Associate	19965620
Giant Cell Arteritis	Associate	30090940, 36597161
Glioblastoma	Associate	30467961
Glioma	Associate	29258522
Graft vs Host Disease	Associate	29513361
Heart Failure	Associate	11511426, 39271913
Helicobacter Infections	Stimulate	30105789, 34008757
Hemangioma Cavernous Central Nervous System	Associate	25472749
Hodgkin Disease	Associate	11468177, 1710152
Hyperandrogenism	Associate	12917504
Hyperostosis corticalis deformans juvenilis	Associate	8840280
Hypoxia	Associate	32028672
Idiopathic Noncirrhotic Portal Hypertension	Associate	37798688
Immunoglobulin G4 Related Disease	Associate	32733444
Infections	Associate	23235494
Inflammation	Associate	12748171, 16425355, 19503017, 20031577, 22013287, 23593036, 24668548, 24940886, 24971461, 25176527, 25781951, 26200663, 26308008, 28276471, 28284938 View all (14 more)
Inflammation	Inhibit	18986700
Inflammatory Bowel Diseases	Associate	24971461, 28276471
Insulin Resistance	Associate	19633828
Insulin Resistance	Stimulate	23771909
Intervertebral Disc Degeneration	Associate	33166496, 36081453
Joint Diseases	Associate	26336855
Leukemia	Associate	1700730, 7919380, 9092685
Leukemia Biphenotypic Acute	Associate	7919380
Leukemia Lymphocytic Chronic B Cell	Associate	30623437
Leukemia Lymphoma Adult T Cell	Associate	9824498
Leukemia Myeloid Acute	Associate	32349161, 7919380
Liver Cirrhosis Biliary	Associate	26336855
Liver Diseases	Associate	19438606
Liver Diseases Alcoholic	Associate	19438606
Lupus Erythematosus Systemic	Associate	11208277, 1563109, 25345743, 8881918
Lymphoma	Associate	37329186
Lymphoma Non Hodgkin	Associate	37809067
Mastocytosis	Associate	23078005
Measles	Associate	17538120
Melanoma	Associate	18781131
Metabolic Diseases	Associate	12917504
Metabolic Syndrome	Associate	18439548, 20186139, 23479153, 23771909, 34931349
Mitral Valve Insufficiency	Associate	27589735
Monoclonal Gammopathy of Undetermined Significance	Stimulate	11090073
Monoclonal Gammopathy of Undetermined Significance	Associate	28540748
Mood Disorders	Associate	34135474
Mouth Neoplasms	Associate	25973020
Multi centric Castleman's Disease	Associate	17550864, 34431136
Multiple Myeloma	Associate	10460618, 10772337, 11090073, 11485567, 11532348, 11754398, 11886382, 14592826, 1587349, 16234364, 16892169, 17003370, 18635812, 19124510, 19228610 View all (11 more)
Multiple Myeloma	Inhibit	14695887
Multiple Sclerosis	Associate	37175706
Myocardial Infarction	Associate	31707836, 39271913
Neoplasm Metastasis	Stimulate	27344294
Neoplasm Metastasis	Associate	27460086, 34730199
Neoplasms	Associate	11090073, 12760309, 18384626, 18490707, 22927533, 24445140, 24854843, 25761055, 26554658, 26892443, 27824145, 28859336, 29665322, 30419338, 31668584 View all (8 more)
Neoplasms	Inhibit	34576335
Neoplasms	Stimulate	8263017
Neoplasms Squamous Cell	Associate	29890775
Nervous System Diseases	Associate	14686749
Neurodegenerative Diseases	Associate	28276471
Neuroinflammatory Diseases	Associate	30836997, 40710309
Neuromyelitis Optica	Associate	21321193, 37863660
Non alcoholic Fatty Liver Disease	Associate	31864032
Obesity	Associate	12917504, 22228719, 26200663, 27907186, 31668584
Obesity	Inhibit	22761857
Osteoarthritis	Associate	37140355
Osteosarcoma	Associate	24854843, 35166635
Osteosarcoma	Stimulate	37774081
Ovarian Neoplasms	Associate	19088723, 25658637, 27825119, 31918995
Pain	Inhibit	22337942
Pancreatic Neoplasms	Associate	31685825
Pancreatitis Chronic	Stimulate	33893003
Paraparesis Tropical Spastic	Associate	9824498
Parkinson Disease	Associate	32884248, 34191436
Plasmacytoma	Stimulate	11090073
Plasmacytoma	Associate	8145046
Pneumonia	Associate	33214204, 34353696, 34931349, 37243282
Pneumonia	Inhibit	35452290
Pneumonia Lipid	Associate	21835044
Polycystic Ovary Syndrome	Associate	40181376, 40287692
Post Acute COVID 19 Syndrome	Associate	39987891
Pre Eclampsia	Associate	18986700
Premature Birth	Associate	29510423
Primary Myelofibrosis	Associate	32923146
Prostatic Neoplasms	Associate	26499200, 27344294, 35465350, 35703345
Prostatic Neoplasms Castration Resistant	Associate	17595657, 27344294
Psychomotor Disorders	Associate	29510423
Psychotic Disorders	Associate	24743863
Pulmonary Arterial Hypertension	Associate	29629898
Pulmonary Disease Chronic Obstructive	Associate	25183374, 27078193, 27561911
Respiratory Tract Infections	Associate	35452290, 39266570
Retroperitoneal Fibrosis	Stimulate	32733444
Rupture	Inhibit	22337942
Schizophrenia	Associate	24743863, 28974776
Sepsis	Associate	33182754
Sjogren's Syndrome	Associate	40298889
Smoldering Multiple Myeloma	Associate	28540748
Spondylitis Ankylosing	Associate	38346238
Stomach Diseases	Associate	34008757
Stomach Neoplasms	Associate	12760309, 20698883, 24886605, 27824145, 34008757
Stroke	Associate	34931349, 36253349
Substance Related Disorders	Associate	31685825
Tendinopathy	Inhibit	22337942
Thrombophilia due to Activated Protein C Resistance	Associate	28540748
Thyroid Cancer Papillary	Associate	34730199
Urinary Bladder Neoplasms	Associate	30744595
Uterine Cervical Neoplasms	Associate	10925276
Uveitis Anterior	Associate	25200001
Vasculitis	Associate	38565387
Venous Thrombosis	Associate	35625609
Waldenstrom Macroglobulinemia	Associate	30279229
Weight Loss	Stimulate	29737494
Wounds and Injuries	Stimulate	34172608

IL6R (interleukin 6 receptor)