Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3570
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 6 receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL6R
Synonyms (NCBI Gene) Gene synonyms aliases
CD126, HIES5, IL-1Ra, IL-6R, IL-6R-1, IL-6RA, IL6Q, IL6QTL, IL6RA, IL6RQ, gp80
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q21.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein comple
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
MIRT005528 hsa-miR-23a-3p GFP reporter assay, Microarray, qRT-PCR, Western blot 20698883
Transcription factors
Transcription factor Regulation Reference
PPARA Repression 14764586
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002384 Process Hepatic immune response TAS 12832423
GO:0002446 Process Neutrophil mediated immunity TAS 16034137
GO:0002548 Process Monocyte chemotaxis IC 10510402
GO:0002690 Process Positive regulation of leukocyte chemotaxis TAS 15100312, 16034137
GO:0004896 Function Cytokine receptor activity IDA 12829785
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147880 6019 ENSG00000160712
Protein
UniProt ID P08887
Protein name Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126) [Cleaved into: Soluble interleukin-6 receptor subunit alpha (sIL6R)]
Protein function Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal (PubMed:28265003). Signal activation necessitate an association with IL6ST. Activation leads to the regulation of the immune response, acute-
PDB 1N26 , 1P9M , 2ARW , 5FUC , 7DC8 , 8D82 , 8IOW , 8QY5 , 8QY6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00047 ig 30 101 Immunoglobulin domain Domain
PF09240 IL6Ra-bind 118 213 Interleukin-6 receptor alpha chain, binding Domain
Tissue specificity TISSUE SPECIFICITY: [Isoform 2]: Expressed in peripheral blood mononuclear cells and weakly found in urine and serum. 1%-20% of the total sIL6R in plasma is generated by alternative splicing (PubMed:28060820). {ECO:0000269|PubMed:28060820}.
Sequence
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGR
PAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGI
LQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
Sequence length 468
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  EGFR tyrosine kinase inhibitor resistance
Cytokine-cytokine receptor interaction
Viral protein interaction with cytokine and cytokine receptor
HIF-1 signaling pathway
PI3K-Akt signaling pathway
JAK-STAT signaling pathway
Hematopoietic cell lineage
Th17 cell differentiation
Non-alcoholic fatty liver disease
Human cytomegalovirus infection
Coronavirus disease - COVID-19
Pathways in cancer
  Interleukin-6 signaling
MAPK3 (ERK1) activation
MAPK1 (ERK2) activation
Interleukin-4 and Interleukin-13 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Asthma Asthma N/A N/A GWAS
Atrial Fibrillation Atrial fibrillation N/A N/A GWAS
Coronary artery disease Coronary artery disease N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 26626881
Acidemia isovaleric Associate 33166496
Acquired Immunodeficiency Syndrome Associate 1693429
Aggressive Periodontitis Associate 28883894
Alzheimer Disease Associate 26626881, 28650998, 36810164
Amyotrophic Lateral Sclerosis Associate 31118040, 31611269, 34075589
Anhedonia Associate 37932834
Anovulation Associate 40287692
Anxiety Associate 32769481
Aortic Aneurysm Associate 30090940