Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3563
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 3 receptor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL3RA
Synonyms (NCBI Gene) Gene synonyms aliases	CD123, IL-3R-alpha, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
Chromosome Chromosome number	X\|Y
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	X;Y
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3),

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments
MIRT2247754	hsa-miR-338-3p	CLIP-seq
MIRT2247755	hsa-miR-4530	CLIP-seq
MIRT2247756	hsa-miR-4676-5p	CLIP-seq
MIRT2247757	hsa-miR-575	CLIP-seq
MIRT2247758	hsa-miR-622	CLIP-seq
MIRT2247759	hsa-miR-933	CLIP-seq
MIRT2247754	hsa-miR-338-3p	CLIP-seq
MIRT2551395	hsa-miR-4520a-5p	CLIP-seq
MIRT2551396	hsa-miR-4520b-5p	CLIP-seq
MIRT2247755	hsa-miR-4530	CLIP-seq
MIRT2247756	hsa-miR-4676-5p	CLIP-seq
MIRT2247757	hsa-miR-575	CLIP-seq
MIRT2247759	hsa-miR-933	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IBA
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004912	Function	Interleukin-3 receptor activity	IDA	29374162
GO:0004912	Function	Interleukin-3 receptor activity	IEA
GO:0004912	Function	Interleukin-3 receptor activity	TAS	1833064
GO:0005515	Function	Protein binding	IPI	29374162, 32296183, 32814053
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	29374162
GO:0005886	Component	Plasma membrane	TAS
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019955	Function	Cytokine binding	IBA
GO:0036016	Process	Cellular response to interleukin-3	IEA
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IDA	8007942, 8649415
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IDA	8649415
GO:0043235	Component	Receptor complex	IBA

MIM	HGNC	e!Ensembl
308385	N/A	HGNC

Protein

UniProt ID

P26951

Protein name

Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)

Protein function

Cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes and B-lymphocytes that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells (PubMed:10527461). Ligand sti

PDB

4JZJ , 5UV8 , 5UWC , 6NMY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18611	IL3Ra_N	27 → 97	IL-3 receptor alpha chain N-terminal domain	Domain
PF09240	IL6Ra-bind	109 → 205	Interleukin-6 receptor alpha chain, binding	Domain

Sequence

MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL
SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL
QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN
TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG
KAGLEECLVTEVQVVQKT

Sequence length

378

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction PI3K-Akt signaling pathway Apoptosis JAK-STAT signaling pathway Hematopoietic cell lineage Pathways in cancer		Interleukin-3, Interleukin-5 and GM-CSF signaling RAF/MAP kinase cascade Interleukin receptor SHC signaling

IL3RA (interleukin 3 receptor subunit alpha)