IL3RA (interleukin 3 receptor subunit alpha)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3563
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 3 receptor subunit alpha
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL3RA
Synonyms (NCBI Gene) Gene synonyms aliases
CD123, IL-3R-alpha, IL3R, IL3RAY, IL3RX, IL3RY, hIL-3Ra
Chromosome Chromosome number
X|Y
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
X;Y
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3),
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT2247754 hsa-miR-338-3p CLIP-seq
MIRT2247755 hsa-miR-4530 CLIP-seq
MIRT2247756 hsa-miR-4676-5p CLIP-seq
MIRT2247757 hsa-miR-575 CLIP-seq
MIRT2247758 hsa-miR-622 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0000165 Process MAPK cascade TAS
GO:0004896 Function Cytokine receptor activity IBA 21873635
GO:0004912 Function Interleukin-3 receptor activity TAS 1833064
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005886 Component Plasma membrane TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
308385 N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P26951
Protein name Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)
Protein function Cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes and B-lymphocytes that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells (PubMed:10527461). Ligand sti
PDB 4JZJ , 5UV8 , 5UWC , 6NMY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18611 IL3Ra_N 27 → 97 IL-3 receptor alpha chain N-terminal domain Domain
PF09240 IL6Ra-bind 109 → 205 Interleukin-6 receptor alpha chain, binding Domain
Sequence 
MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSM
PAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFL
SCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSS
HILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYEL
QIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGAN
TRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAG
KAGLEECLVTEVQVVQKT
Sequence length 378
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Apoptosis
JAK-STAT signaling pathway
Hematopoietic cell lineage
Pathways in cancer 		  Interleukin-3, Interleukin-5 and GM-CSF signaling
RAF/MAP kinase cascade
Interleukin receptor SHC signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 19281803, 17522711, 18547720
Show/Hide Text Mining Associations (83)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 35833114
Anemia Diamond Blackfan Associate 25755292
Arthritis Infectious Associate 32849606
Arthritis Juvenile Associate 32849606
Arthritis Rheumatoid Associate 15743469
Ataxia Telangiectasia Associate 26474588
Bone Marrow Diseases Associate 29415975
Breast Neoplasms Associate 37684436
Carcinoma Non Small Cell Lung Associate 31556561
Carcinoma Squamous Cell Associate 33671013