Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3560
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 2 receptor subunit beta
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL2RB
Synonyms (NCBI Gene) Gene synonyms aliases	CD122, IL15RB, IMD63, P70-75
Chromosome Chromosome number	22
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	22q12.3
Summary Summary of gene provided in NCBI Entrez Gene.	The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The

Show/Hide all(2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1569044747	G>A	Pathogenic	Coding sequence variant, stop gained
rs1601598133	GGCTCCAGG>-	Pathogenic	Inframe deletion, coding sequence variant

Show/Hide all(116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT475221	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT475220	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT475219	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT475218	hsa-miR-4419a	PAR-CLIP	23592263
MIRT475217	hsa-miR-4510	PAR-CLIP	23592263
MIRT475216	hsa-miR-6127	PAR-CLIP	23592263
MIRT475215	hsa-miR-6129	PAR-CLIP	23592263
MIRT475214	hsa-miR-6130	PAR-CLIP	23592263
MIRT475213	hsa-miR-6133	PAR-CLIP	23592263
MIRT475211	hsa-miR-4300	PAR-CLIP	23592263
MIRT475212	hsa-miR-5591-5p	PAR-CLIP	23592263
MIRT475210	hsa-miR-6726-5p	PAR-CLIP	23592263
MIRT475209	hsa-miR-920	PAR-CLIP	23592263
MIRT475208	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT475207	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT475206	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT475204	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT475205	hsa-miR-4455	PAR-CLIP	23592263
MIRT475203	hsa-miR-4316	PAR-CLIP	23592263
MIRT475202	hsa-miR-1294	PAR-CLIP	23592263
MIRT475201	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT475221	hsa-miR-6732-5p	PAR-CLIP	23592263
MIRT475220	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT475219	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT475218	hsa-miR-4419a	PAR-CLIP	23592263
MIRT475217	hsa-miR-4510	PAR-CLIP	23592263
MIRT475216	hsa-miR-6127	PAR-CLIP	23592263
MIRT475215	hsa-miR-6129	PAR-CLIP	23592263
MIRT475214	hsa-miR-6130	PAR-CLIP	23592263
MIRT475213	hsa-miR-6133	PAR-CLIP	23592263
MIRT475211	hsa-miR-4300	PAR-CLIP	23592263
MIRT475212	hsa-miR-5591-5p	PAR-CLIP	23592263
MIRT475210	hsa-miR-6726-5p	PAR-CLIP	23592263
MIRT475209	hsa-miR-920	PAR-CLIP	23592263
MIRT475208	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT475207	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT475206	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT475204	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT475205	hsa-miR-4455	PAR-CLIP	23592263
MIRT475203	hsa-miR-4316	PAR-CLIP	23592263
MIRT475202	hsa-miR-1294	PAR-CLIP	23592263
MIRT475201	hsa-miR-6834-5p	PAR-CLIP	23592263
MIRT1064826	hsa-miR-103a	CLIP-seq
MIRT1064827	hsa-miR-107	CLIP-seq
MIRT1064828	hsa-miR-1224-5p	CLIP-seq
MIRT1064829	hsa-miR-1269	CLIP-seq
MIRT1064830	hsa-miR-1269b	CLIP-seq
MIRT1064831	hsa-miR-1288	CLIP-seq
MIRT1064832	hsa-miR-214	CLIP-seq
MIRT1064833	hsa-miR-3127-5p	CLIP-seq
MIRT1064834	hsa-miR-3619-5p	CLIP-seq
MIRT1064835	hsa-miR-3909	CLIP-seq
MIRT1064836	hsa-miR-3918	CLIP-seq
MIRT1064837	hsa-miR-4291	CLIP-seq
MIRT1064838	hsa-miR-4515	CLIP-seq
MIRT1064839	hsa-miR-4519	CLIP-seq
MIRT1064840	hsa-miR-4687-5p	CLIP-seq
MIRT1064841	hsa-miR-4711-5p	CLIP-seq
MIRT1064842	hsa-miR-4740-5p	CLIP-seq
MIRT1064843	hsa-miR-4751	CLIP-seq
MIRT1064844	hsa-miR-4755-3p	CLIP-seq
MIRT1064845	hsa-miR-522	CLIP-seq
MIRT1064846	hsa-miR-761	CLIP-seq
MIRT1064847	hsa-miR-885-3p	CLIP-seq
MIRT1064848	hsa-miR-922	CLIP-seq
MIRT2015424	hsa-miR-15a	CLIP-seq
MIRT2015425	hsa-miR-15b	CLIP-seq
MIRT2015426	hsa-miR-16	CLIP-seq
MIRT2015427	hsa-miR-195	CLIP-seq
MIRT1064832	hsa-miR-214	CLIP-seq
MIRT1064834	hsa-miR-3619-5p	CLIP-seq
MIRT2015428	hsa-miR-424	CLIP-seq
MIRT1064839	hsa-miR-4519	CLIP-seq
MIRT2015429	hsa-miR-497	CLIP-seq
MIRT1064846	hsa-miR-761	CLIP-seq
MIRT2247724	hsa-miR-1207-5p	CLIP-seq
MIRT2247725	hsa-miR-1914	CLIP-seq
MIRT2247726	hsa-miR-1915	CLIP-seq
MIRT1064833	hsa-miR-3127-5p	CLIP-seq
MIRT2247727	hsa-miR-3151	CLIP-seq
MIRT2247728	hsa-miR-34a	CLIP-seq
MIRT2247729	hsa-miR-34c-5p	CLIP-seq
MIRT2247730	hsa-miR-3616-3p	CLIP-seq
MIRT2247731	hsa-miR-3649	CLIP-seq
MIRT1064836	hsa-miR-3918	CLIP-seq
MIRT2247732	hsa-miR-4278	CLIP-seq
MIRT2247733	hsa-miR-4283	CLIP-seq
MIRT2247734	hsa-miR-4436b-3p	CLIP-seq
MIRT2247735	hsa-miR-4459	CLIP-seq
MIRT2247736	hsa-miR-4489	CLIP-seq
MIRT2247737	hsa-miR-449a	CLIP-seq
MIRT2247738	hsa-miR-449b	CLIP-seq
MIRT2247739	hsa-miR-4648	CLIP-seq
MIRT2247740	hsa-miR-4656	CLIP-seq
MIRT2247741	hsa-miR-4716-3p	CLIP-seq
MIRT2247742	hsa-miR-4721	CLIP-seq
MIRT2247743	hsa-miR-4722-5p	CLIP-seq
MIRT2247744	hsa-miR-4763-3p	CLIP-seq
MIRT2247745	hsa-miR-4795-5p	CLIP-seq
MIRT2247746	hsa-miR-492	CLIP-seq
MIRT2430015	hsa-miR-1225-3p	CLIP-seq
MIRT2430016	hsa-miR-3911	CLIP-seq
MIRT2430017	hsa-miR-4527	CLIP-seq
MIRT2437895	hsa-miR-138	CLIP-seq
MIRT2247727	hsa-miR-3151	CLIP-seq
MIRT2437896	hsa-miR-3929	CLIP-seq
MIRT2437897	hsa-miR-4419b	CLIP-seq
MIRT2437898	hsa-miR-4447	CLIP-seq
MIRT2437899	hsa-miR-4472	CLIP-seq
MIRT2437900	hsa-miR-4478	CLIP-seq
MIRT2437901	hsa-miR-491-5p	CLIP-seq
MIRT2451766	hsa-miR-296-5p	CLIP-seq
MIRT2451767	hsa-miR-635	CLIP-seq
MIRT2451768	hsa-miR-890	CLIP-seq
MIRT2451769	hsa-miR-938	CLIP-seq
MIRT2551234	hsa-miR-4312	CLIP-seq

Transcription factors

Show/Hide all(5)

Transcription factor	Regulation	Reference
EGR1	Unknown	9199305
ETS1	Activation	8413220
RXRA	Activation	12149223
SP1	Unknown	9199305
WT1	Unknown	11960373

Show/Hide all(41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004896	Function	Cytokine receptor activity	IEA
GO:0004911	Function	Interleukin-2 receptor activity	IBA
GO:0004911	Function	Interleukin-2 receptor activity	IDA	7736574
GO:0004911	Function	Interleukin-2 receptor activity	IMP	2467293
GO:0004911	Function	Interleukin-2 receptor activity	IMP	31040184, 31040185
GO:0005515	Function	Protein binding	IPI	16477002, 22446627, 23104097, 25416956, 32296183
GO:0005768	Component	Endosome	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IC	7973659
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	31040184, 31040185
GO:0005886	Component	Plasma membrane	TAS	2467293, 8514792
GO:0005893	Component	Interleukin-2 receptor complex	TAS	2467293
GO:0007165	Process	Signal transduction	TAS	2785715
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009897	Component	External side of plasma membrane	ISS
GO:0009986	Component	Cell surface	IDA	15123770
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	IMP	31040184, 31040185
GO:0015026	Function	Coreceptor activity	IDA	7973659, 8026467
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016064	Process	Immunoglobulin mediated immune response	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IDA	7736574
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019976	Function	Interleukin-2 binding	IBA
GO:0019976	Function	Interleukin-2 binding	IEA
GO:0019976	Function	Interleukin-2 binding	IMP	2467293, 31040184, 31040185
GO:0019976	Function	Interleukin-2 binding	ISS
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	7568001
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IMP	15123770, 31040184
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IBA
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	7568005, 7973659, 8631883
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	7973659
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IMP	31040184
GO:0038110	Process	Interleukin-2-mediated signaling pathway	TAS	2467293
GO:0042010	Function	Interleukin-15 receptor activity	IDA	15123770
GO:0043066	Process	Negative regulation of apoptotic process	IDA	7736574
GO:0050766	Process	Positive regulation of phagocytosis	IMP	15123770
GO:0065003	Process	Protein-containing complex assembly	TAS	2467293

MIM	HGNC	e!Ensembl
146710	6009	ENSG00000100385

Protein

UniProt ID

P14784

Protein name

Interleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (Interleukin-15 receptor subunit beta) (p70-75) (p75) (CD antigen CD122)

Protein function

Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15 (PubMed:1

PDB

2B5I , 2ERJ , 3QAZ , 4GS7 , 5M5E , 6E8K , 7S2S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18707	IL2RB_N1	32 → 123	Interleukin-2 receptor subunit beta N-terminal domain 1	Domain

Sequence

MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
ELQGQDPTHLV

Sequence length

551

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Endocytosis PI3K-Akt signaling pathway JAK-STAT signaling pathway Th1 and Th2 cell differentiation Th17 cell differentiation Measles Human T-cell leukemia virus 1 infection Pathways in cancer Transcriptional misregulation in cancer		RAF/MAP kinase cascade Interleukin-15 signaling Interleukin-2 signaling Interleukin receptor SHC signaling

Show/Hide Causal Diseases (2)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Immunodeficiency	Immunodeficiency 63 with lymphoproliferation and autoimmunity	rs1922072844, rs934523851	N/A
ichthyosis	Ichthyosis	rs1569044747	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Asthma	N/A	N/A	GWAS
Rheumatoid arthritis	Rheumatoid arthritis	N/A	N/A	GWAS

Show/Hide Text Mining Associations (127)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Acquired Immunodeficiency Syndrome	Associate	1696861, 3115647, 3924451, 6609030
Acrocephalosyndactylia	Associate	31040185
Adrenoleukodystrophy	Associate	32072341
AIDS Related Complex	Inhibit	1696861
Anemia Aplastic	Associate	2981588
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	24648606
Arthritis	Associate	30299251
Arthritis Juvenile	Associate	8733441
Arthritis Psoriatic	Associate	2428913
Arthritis Rheumatoid	Associate	1563102, 17257224, 18794857, 21875375, 22355377, 23261300, 3089651, 31134763, 3127092
Asthma	Associate	20860503, 22069270, 25895113, 33656624
Ataxia Telangiectasia	Associate	22948044
Autoimmune Diseases	Associate	23676143, 24376757, 29339359, 31040184, 38179754
Behcet Syndrome	Associate	9030859
beta Thalassemia	Associate	27228385
Bipolar Disorder	Associate	16380905
Breast Neoplasms	Associate	2044083, 29339359, 9878115
Carcinogenesis	Associate	38565343
Celiac Disease	Associate	21875375
Cholangitis Sclerosing	Inhibit	11413121
Cholangitis Sclerosing	Associate	17162367, 36059513
Chronic Disease	Associate	1563102
Chronobiology Disorders	Associate	35039330
Cognitive Dysfunction	Associate	17903520
Colorectal Neoplasms	Associate	20846378, 25516661, 29713043
Congenital Abnormalities	Associate	3924451
Coronary Disease	Associate	36060667
COVID 19	Associate	34392110, 39377750
Cytomegalovirus Infections	Associate	31040184, 31040185
Dermatitis Atopic	Associate	28821884
Diabetes Mellitus Type 1	Associate	19155502, 19875613, 22069270, 24210274, 24376757
Drug Related Side Effects and Adverse Reactions	Inhibit	2146981
Drug Related Side Effects and Adverse Reactions	Stimulate	2787694
Eczema	Associate	33656624
Endometriosis	Associate	16084898
Glomerulonephritis IGA	Associate	1477028, 2785227
Granulomatosis with Polyangiitis	Associate	35039330
Graves Disease	Associate	9222097
Heart Failure Diastolic	Associate	36266995
Hemophilia A	Associate	1735193
Hepatitis C Chronic	Associate	19747917
Hepatitis Chronic	Associate	1385768
Hereditary Angioedema Type III	Associate	29339359
Hereditary leiomyomatosis and renal cell cancer	Associate	8506943
HIV Infections	Associate	10973452, 18490721, 2968201, 8093435
HIV Infections	Inhibit	19239367
Hodgkin Disease	Associate	1691591, 3103454, 8506943
HTLV I Infections	Associate	1982452, 2121691
HTLV II Infections	Associate	1474936
Hypergammaglobulinemia	Associate	31040185
Hypertension	Associate	30530896, 37675573
Hyperthyroidism	Associate	9222097
Idiopathic Pulmonary Fibrosis	Associate	14680494
IgA Vasculitis	Associate	3127092
Immunologic Deficiency Syndromes	Associate	11468191, 31040184
Infections	Associate	15162441, 9756745
Infectious Mononucleosis	Associate	2295000
Inflammation	Associate	17903520, 20860503, 24523387, 31040185
Inflammatory Bowel Diseases	Associate	25895113
Intervertebral Disc Degeneration	Associate	36081453
Intraocular Lymphoma	Associate	10377437
Kidney Failure Chronic	Associate	2150086
Leukemia	Associate	2121691, 2383656, 2503474, 2787681, 2866223, 2891729, 2900231, 2992637, 3110786, 3115332, 7519476, 8107488, 8605349
Leukemia	Stimulate	3876124
Leukemia B Cell	Associate	12149223, 3009062
Leukemia Hairy Cell	Associate	3009062, 8329708, 8605349
Leukemia Large Granular Lymphocytic	Associate	2146981, 2383656, 2833327, 3110786, 3125866
Leukemia Lymphocytic Chronic B Cell	Associate	20544350, 21044363, 8107488, 8605349
Leukemia Lymphoma Adult T Cell	Associate	2121691, 2383656, 2789474, 2889484, 2891729, 2900231, 2993359, 2999698
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	2787681, 3103714
Leukemia Myeloid Acute	Associate	3103714
Leukemia Prolymphocytic T Cell	Associate	15566356, 3080037, 3121222
Leukemia T Cell	Associate	12149223, 1379847, 15811959
Liver Cirrhosis Alcoholic	Associate	3262458
Liver Diseases Alcoholic	Associate	1676985
Lupus Erythematosus Systemic	Associate	17257224
Lupus Erythematosus Systemic	Inhibit	8881918
Lymphatic Diseases	Stimulate	3100439
Lymphatic Diseases	Associate	31040185
Lymphocytosis	Associate	7910532
Lymphoma	Associate	15811959, 2305833, 2789474, 8107488
Lymphoma B Cell	Associate	3103454
Lymphoma Follicular	Associate	3103454
Lymphoma Non Hodgkin	Associate	7553687
Lymphoma T Cell Cutaneous	Associate	21346774
Lymphopenia	Associate	2787694
Lymphopenia	Stimulate	34392110
Lymphoproliferative Disorders	Associate	8605349
Macrophage Activation Syndrome	Associate	40514742
Melanoma	Associate	11125310, 15471828, 22027907, 30718426
Mucocutaneous Lymph Node Syndrome	Stimulate	35924269
Multiple Myeloma	Associate	1832993
Multiple Sclerosis	Associate	19155502, 20179739, 21875375, 24376757, 2458871, 27162345, 3085102
Myeloproliferative Disorder Chronic with Eosinophilia	Associate	3103454
Myocardial Infarction	Associate	29713043
Myositis	Associate	1835892
Neoplasms	Associate	10555752, 12797908, 15471828, 16220324, 29339359, 3103454, 31040185, 32616554, 34349241, 34715892, 7923243, 9769118
Neuropathy Painful	Associate	14686749
Non alcoholic Fatty Liver Disease	Associate	36266995
Obesity	Associate	29713043
Oligodendroglioma	Associate	2395860
Ovarian Neoplasms	Associate	36837407, 38565343
Pain	Associate	14686749, 35531763
Paraparesis Tropical Spastic	Associate	17409595, 31402625
Pemphigus	Associate	6432916
Persistent Infection	Associate	22761386
Pre Eclampsia	Associate	34894939
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	2383656, 3094603
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	22948044, 2383656
Primary Immunodeficiency Diseases	Associate	31040184, 38644452
Prostatic Neoplasms	Associate	17115417
Prostatic Neoplasms	Inhibit	35061708
Pulmonary Disease Chronic Obstructive	Associate	36655999
Pyruvate Carboxylase Deficiency Disease	Associate	1929608
Rheumatic Diseases	Associate	8976644
Sarcoidosis	Associate	3138285
Sepsis	Associate	39377750
Severe Combined Immunodeficiency	Associate	11468191
Sjogren's Syndrome	Associate	36881472
Sleep Wake Disorders	Associate	11468191
Spondylitis Ankylosing	Associate	38179754
Thalassemia	Associate	27228385
Tuberculosis	Associate	3114146
Uveitis	Associate	10377437
Uveitis Anterior	Associate	15043537
Waldenstrom Macroglobulinemia	Associate	21921047
X Linked Combined Immunodeficiency Diseases	Associate	32072341, 33959125, 8605323

IL2RB (interleukin 2 receptor subunit beta)