Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3559
Gene name	Interleukin 2 receptor subunit alpha
Gene symbol	IL2RA
Synonyms (NCBI Gene)	CD25IDDM10IL2RIMD41TCGFRp55
Chromosome	10
Chromosome location	10p15.1
Summary	The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2R

Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs72650666	G>A	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs773957702	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs774803573	G>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs796051887	C>T	Pathogenic	Coding sequence variant, intron variant, missense variant
rs796051888	T>G	Pathogenic	Coding sequence variant, missense variant
rs886041032	CCTG>-	Pathogenic	Coding sequence variant, splice donor variant
rs886041037	G>A	Pathogenic	Stop gained, coding sequence variant
rs886041038	->T	Pathogenic	Coding sequence variant, frameshift variant
rs1554829311	T>C	Pathogenic	Intron variant, splice acceptor variant

341

Show/Hide all (341)

miRTarBase ID	miRNA	Experiments	Reference
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT644980	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT644979	hsa-miR-5691	HITS-CLIP	23824327
MIRT644978	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT671563	hsa-miR-4513	HITS-CLIP	23824327
MIRT671564	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT671562	hsa-miR-6857-3p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT644980	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT671561	hsa-miR-3136-5p	HITS-CLIP	23824327
MIRT671560	hsa-miR-4439	HITS-CLIP	23824327
MIRT644979	hsa-miR-5691	HITS-CLIP	23824327
MIRT644978	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT662586	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT662585	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT662584	hsa-miR-4302	HITS-CLIP	23824327
MIRT662583	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT662582	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT662581	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT662580	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT662579	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT662578	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT662577	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT662576	hsa-miR-1248	HITS-CLIP	23824327
MIRT662575	hsa-miR-4469	HITS-CLIP	23824327
MIRT662574	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT662573	hsa-miR-4287	HITS-CLIP	23824327
MIRT662572	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT662571	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT662570	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT662569	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT662568	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT662567	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT662566	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT662565	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT662564	hsa-miR-7973	HITS-CLIP	23824327
MIRT662563	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT662562	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT662561	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT662560	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT662559	hsa-miR-6808-3p	HITS-CLIP	23824327
MIRT662558	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT644980	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT644979	hsa-miR-5691	HITS-CLIP	23824327
MIRT644978	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT644980	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT644979	hsa-miR-5691	HITS-CLIP	23824327
MIRT644978	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT644980	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT644979	hsa-miR-5691	HITS-CLIP	23824327
MIRT644978	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT671563	hsa-miR-4513	HITS-CLIP	23824327
MIRT671564	hsa-miR-6855-3p	HITS-CLIP	23824327
MIRT671562	hsa-miR-6857-3p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT644980	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT671561	hsa-miR-3136-5p	HITS-CLIP	23824327
MIRT671560	hsa-miR-4439	HITS-CLIP	23824327
MIRT644979	hsa-miR-5691	HITS-CLIP	23824327
MIRT644978	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT662586	hsa-miR-188-5p	HITS-CLIP	23824327
MIRT662585	hsa-miR-6866-3p	HITS-CLIP	23824327
MIRT662584	hsa-miR-4302	HITS-CLIP	23824327
MIRT662583	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT662582	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT662581	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT662580	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT662579	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT662578	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT662577	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT662576	hsa-miR-1248	HITS-CLIP	23824327
MIRT662575	hsa-miR-4469	HITS-CLIP	23824327
MIRT662574	hsa-miR-7113-3p	HITS-CLIP	23824327
MIRT662573	hsa-miR-4287	HITS-CLIP	23824327
MIRT662572	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT662571	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT662570	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT662569	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT662568	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT662567	hsa-miR-3124-3p	HITS-CLIP	23824327
MIRT662566	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT662565	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT662564	hsa-miR-7973	HITS-CLIP	23824327
MIRT662563	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT662562	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT662561	hsa-miR-4713-5p	HITS-CLIP	23824327
MIRT662560	hsa-miR-6867-3p	HITS-CLIP	23824327
MIRT662559	hsa-miR-6808-3p	HITS-CLIP	23824327
MIRT662558	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT644980	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT644979	hsa-miR-5691	HITS-CLIP	23824327
MIRT644978	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT644980	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT644979	hsa-miR-5691	HITS-CLIP	23824327
MIRT644978	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT631408	hsa-miR-1267	HITS-CLIP	23824327
MIRT631407	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT631406	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT631405	hsa-miR-3135b	HITS-CLIP	23824327
MIRT631404	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT631403	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT631402	hsa-miR-3652	HITS-CLIP	23824327
MIRT631401	hsa-miR-4430	HITS-CLIP	23824327
MIRT631400	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT631399	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT631398	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT631397	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT631396	hsa-miR-5698	HITS-CLIP	23824327
MIRT1064804	hsa-miR-1	CLIP-seq
MIRT1064805	hsa-miR-122	CLIP-seq
MIRT1064806	hsa-miR-1266	CLIP-seq
MIRT1064807	hsa-miR-1273f	CLIP-seq
MIRT1064808	hsa-miR-143	CLIP-seq
MIRT1064809	hsa-miR-206	CLIP-seq
MIRT1064810	hsa-miR-3545-3p	CLIP-seq
MIRT1064811	hsa-miR-3664-3p	CLIP-seq
MIRT1064812	hsa-miR-3673	CLIP-seq
MIRT1064813	hsa-miR-4496	CLIP-seq
MIRT1064814	hsa-miR-4518	CLIP-seq
MIRT1064815	hsa-miR-4646-5p	CLIP-seq
MIRT1064816	hsa-miR-4708-5p	CLIP-seq
MIRT1064817	hsa-miR-4747-5p	CLIP-seq
MIRT1064818	hsa-miR-4770	CLIP-seq
MIRT1064819	hsa-miR-507	CLIP-seq
MIRT1064820	hsa-miR-511	CLIP-seq
MIRT1064821	hsa-miR-548u	CLIP-seq
MIRT1064822	hsa-miR-557	CLIP-seq
MIRT1064823	hsa-miR-581	CLIP-seq
MIRT1064824	hsa-miR-613	CLIP-seq
MIRT1064825	hsa-miR-873	CLIP-seq
MIRT1064805	hsa-miR-122	CLIP-seq
MIRT1064805	hsa-miR-122	CLIP-seq
MIRT2015410	hsa-miR-1343	CLIP-seq
MIRT2015411	hsa-miR-15a	CLIP-seq
MIRT2015412	hsa-miR-15b	CLIP-seq
MIRT2015413	hsa-miR-16	CLIP-seq
MIRT2015414	hsa-miR-195	CLIP-seq
MIRT2015415	hsa-miR-1976	CLIP-seq
MIRT2015416	hsa-miR-378g	CLIP-seq
MIRT2015417	hsa-miR-424	CLIP-seq
MIRT2015418	hsa-miR-4437	CLIP-seq
MIRT2015419	hsa-miR-4486	CLIP-seq
MIRT2015420	hsa-miR-4649-5p	CLIP-seq
MIRT2015421	hsa-miR-4674	CLIP-seq
MIRT2015422	hsa-miR-4722-3p	CLIP-seq
MIRT2015423	hsa-miR-497	CLIP-seq
MIRT2247714	hsa-miR-1184	CLIP-seq
MIRT2247715	hsa-miR-1200	CLIP-seq
MIRT1064805	hsa-miR-122	CLIP-seq
MIRT2015410	hsa-miR-1343	CLIP-seq
MIRT2015415	hsa-miR-1976	CLIP-seq
MIRT2015416	hsa-miR-378g	CLIP-seq
MIRT2247716	hsa-miR-4324	CLIP-seq
MIRT2247717	hsa-miR-4418	CLIP-seq
MIRT2015418	hsa-miR-4437	CLIP-seq
MIRT2247718	hsa-miR-4481	CLIP-seq
MIRT2015421	hsa-miR-4674	CLIP-seq
MIRT2015422	hsa-miR-4722-3p	CLIP-seq
MIRT2247719	hsa-miR-4745-5p	CLIP-seq
MIRT2247720	hsa-miR-4758-5p	CLIP-seq
MIRT2247721	hsa-miR-509-3-5p	CLIP-seq
MIRT2247722	hsa-miR-509-5p	CLIP-seq
MIRT2247723	hsa-miR-544b	CLIP-seq
MIRT2247714	hsa-miR-1184	CLIP-seq
MIRT2247715	hsa-miR-1200	CLIP-seq
MIRT1064805	hsa-miR-122	CLIP-seq
MIRT2389376	hsa-miR-370	CLIP-seq
MIRT2389377	hsa-miR-378	CLIP-seq
MIRT2389378	hsa-miR-378b	CLIP-seq
MIRT2389379	hsa-miR-378c	CLIP-seq
MIRT2389380	hsa-miR-378d	CLIP-seq
MIRT2389381	hsa-miR-378e	CLIP-seq
MIRT2389382	hsa-miR-378f	CLIP-seq
MIRT2389383	hsa-miR-378h	CLIP-seq
MIRT2389384	hsa-miR-378i	CLIP-seq
MIRT2389385	hsa-miR-422a	CLIP-seq
MIRT2247716	hsa-miR-4324	CLIP-seq
MIRT2247717	hsa-miR-4418	CLIP-seq
MIRT2389386	hsa-miR-4427	CLIP-seq
MIRT2247718	hsa-miR-4481	CLIP-seq
MIRT2389387	hsa-miR-4638-3p	CLIP-seq
MIRT2389388	hsa-miR-4680-3p	CLIP-seq
MIRT2015422	hsa-miR-4722-3p	CLIP-seq
MIRT2389389	hsa-miR-4725-5p	CLIP-seq
MIRT2247719	hsa-miR-4745-5p	CLIP-seq
MIRT2247720	hsa-miR-4758-5p	CLIP-seq
MIRT2389390	hsa-miR-504	CLIP-seq
MIRT1064819	hsa-miR-507	CLIP-seq
MIRT2247721	hsa-miR-509-3-5p	CLIP-seq
MIRT2247722	hsa-miR-509-5p	CLIP-seq
MIRT2247723	hsa-miR-544b	CLIP-seq
MIRT1064822	hsa-miR-557	CLIP-seq
MIRT1064823	hsa-miR-581	CLIP-seq
MIRT2389391	hsa-miR-711	CLIP-seq
MIRT2247715	hsa-miR-1200	CLIP-seq
MIRT1064805	hsa-miR-122	CLIP-seq
MIRT2015415	hsa-miR-1976	CLIP-seq
MIRT2247716	hsa-miR-4324	CLIP-seq
MIRT2247718	hsa-miR-4481	CLIP-seq
MIRT2015422	hsa-miR-4722-3p	CLIP-seq
MIRT2247719	hsa-miR-4745-5p	CLIP-seq
MIRT2247720	hsa-miR-4758-5p	CLIP-seq
MIRT2247723	hsa-miR-544b	CLIP-seq
MIRT1064805	hsa-miR-122	CLIP-seq
MIRT1064805	hsa-miR-122	CLIP-seq

Show/Hide all (11)

Transcription factor	Regulation	Reference
FOXP3	Activation	21036387
MSC	Activation	19561533
NFKB1	Unknown	11781710;9135552
POU2F1	Unknown	9135552
REL	Activation	1508203
RELA	Unknown	11781710;9135552
RXRA	Activation	12149223
SATB1	Unknown	15713622
STAT1	Unknown	10068671;12244150
STAT3	Unknown	10068671;11368440;24159173
STAT4	Unknown	10068671

Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0002437	Process	Inflammatory response to antigenic stimulus	IEA
GO:0002664	Process	Regulation of T cell tolerance induction	IMP	23416241
GO:0002682	Process	Regulation of immune system process	IEA
GO:0004911	Function	Interleukin-2 receptor activity	IDA	16293754
GO:0004911	Function	Interleukin-2 receptor activity	IEA
GO:0004911	Function	Interleukin-2 receptor activity	IMP	2467293
GO:0004911	Function	Interleukin-2 receptor activity	TAS	9096364
GO:0005515	Function	Protein binding	IPI	16477002, 17032757
GO:0005886	Component	Plasma membrane	IC	16293754
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2467293, 2983318
GO:0005893	Component	Interleukin-2 receptor complex	TAS	2467293
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	9096364
GO:0006924	Process	Activation-induced cell death of T cells	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006955	Process	Immune response	IEA
GO:0006955	Process	Immune response	TAS	9096364
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	2983318
GO:0007219	Process	Notch signaling pathway	IEA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0019976	Function	Interleukin-2 binding	IBA
GO:0019976	Function	Interleukin-2 binding	IEA
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	7568005, 7973659, 8631883
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	16293754
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042130	Process	Negative regulation of T cell proliferation	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0045582	Process	Positive regulation of T cell differentiation	IEA
GO:0046013	Process	Regulation of T cell homeostatic proliferation	IEA
GO:0046651	Process	Lymphocyte proliferation	IEA
GO:0050672	Process	Negative regulation of lymphocyte proliferation	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050798	Process	Activated T cell proliferation	IEA
GO:2000561	Process	Regulation of CD4-positive, alpha-beta T cell proliferation	IEA

MIM	HGNC	e!Ensembl
147730	6008	ENSG00000134460

P01589

Protein name

Interleukin-2 receptor subunit alpha (IL-2 receptor subunit alpha) (IL-2-RA) (IL-2R subunit alpha) (IL2-RA) (TAC antigen) (p55) (CD antigen CD25)

Protein function

Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells. {ECO:0000269|PubMed:23416241, ECO

PDB

1Z92 , 2B5I , 2ERJ , 3IU3 , 3NFP , 6VWU , 6YIO , 7F9W , 7ZMZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00084	Sushi	24 → 82	Sushi repeat (SCR repeat)	Domain

Sequence

MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI

Sequence length

272

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Viral protein interaction with cytokine and cytokine receptor Endocytosis PI3K-Akt signaling pathway JAK-STAT signaling pathway Hematopoietic cell lineage Th1 and Th2 cell differentiation Th17 cell differentiation Measles Human T-cell leukemia virus 1 infection Pathways in cancer		RAF/MAP kinase cascade RUNX1 and FOXP3 control the development of regulatory T lymphocytes (Tregs) Interleukin-2 signaling Interleukin receptor SHC signaling

305

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Immunodeficiency due to CD25 deficiency	Likely pathogenic; Pathogenic	rs2132853537, rs886041037, rs886041038, rs796051887, rs796051888, rs1250584991, rs2539649661, rs2539643473, rs886041032, rs774803573	RCV002040509 RCV000185639 RCV000185640 RCV000185641 RCV000185642 RCV002663884 RCV002881206 RCV003629422 RCV000015780 RCV000814187

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Acute myeloid leukemia	Uncertain significance	rs12722699	RCV005924325
Cholangiocarcinoma	Benign	rs28360490	RCV005909324
IL2RA-related disorder	Likely benign; Conflicting classifications of pathogenicity	rs767262856, rs41295061, rs11594656, rs72650666, rs774599486	RCV003900730 RCV003944824 RCV003944825 RCV003925437 RCV003925819
Lymphoma	Benign	rs28360490	RCV005909322
Malignant lymphoma, large B-cell, diffuse	Benign; Uncertain significance; -	rs28360490, rs138645280, rs267602536	RCV005909321 RCV005928479 RCV006033922
Malignant tumor of esophagus	Uncertain significance; Conflicting classifications of pathogenicity	rs138645280, rs74162097	RCV005928478 RCV005891839
Myelodysplasia	Uncertain significance	rs143550766	RCV002244747
Pleural effusion	Uncertain significance	rs143550766	RCV002244747
Type 1 diabetes mellitus 10	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	rs142016545, rs41295061, rs11594656, rs748515506, rs373973017, rs147791171	RCV002476506 RCV005257994 RCV000015782 RCV000768237 RCV002482187 RCV002491696
Uterine carcinosarcoma	Benign	rs28360490	RCV005909323

Show/Hide Text Mining Associations (419)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
3 Hydroxy 3 Methylglutaryl CoA Lyase Deficiency	Associate	18362907
Abortion Habitual	Associate	26345847
Abortion Spontaneous	Associate	26261529
Acquired Immunodeficiency Syndrome	Associate	1735193, 2295695, 2581997, 2957130
Acrocephalosyndactylia	Associate	23330016
Acrocephalosyndactylia	Inhibit	24385687
Actinic cheilitis	Associate	25060152
Acute Coronary Syndrome	Associate	23330016, 25612606, 25740578
Acute Coronary Syndrome	Inhibit	24385687, 24603196
Acute Disease	Associate	1628427
Acute On Chronic Liver Failure	Associate	34869773
Addison Disease	Associate	25347332
Adenocarcinoma of Lung	Associate	32616892, 33480074
adult multisystem inflammatory disease COVID 19 related	Associate	37092638
Aicardi Goutieres syndrome	Associate	23408864
AIDS Related Complex	Associate	1735193
Alopecia Areata	Associate	20596022, 29080678
Alopecia universalis	Associate	7511865
Alveolitis Extrinsic Allergic	Associate	27792269
Androgen Insensitivity Syndrome	Inhibit	31598989
Anemia	Associate	21442636
Anemia Aplastic	Associate	17463169, 24845454
Anemia Pernicious	Associate	34145262
Angina Stable	Associate	8080984
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Stimulate	15762890
Anti Neutrophil Cytoplasmic Antibody Associated Vasculitis	Associate	19265545, 24648606, 8455368
Antiphospholipid Syndrome	Associate	25862984
Arthritis	Associate	26561546
Arthritis Juvenile	Associate	15939793, 16263787, 19116909, 19674979, 20072139, 22294642, 25092890, 26561546, 32730263, 8733441
Arthritis Reactive	Associate	17425604
Arthritis Rheumatoid	Associate	10700427, 15457445, 17200409, 17257224, 17328044, 17587349, 18512781, 19116909, 21155991, 21875375, 22355377, 22488116, 23121884, 23261300, 23280063 View all (21 more)
Arthritis Rheumatoid	Inhibit	19886735, 3262468
Arthritis Rheumatoid	Stimulate	23165362, 9665944
Ascites	Associate	12942579
Asthma	Associate	1534311, 17349011, 18581330, 18832695, 19152963, 19610265, 23893806, 29809062
Asthma	Stimulate	29297467, 36685514
Ataxia Telangiectasia	Stimulate	18505566
Atherosclerosis	Associate	19406979, 26293465, 26383248, 26822994
Attention Deficit Disorder with Hyperactivity	Associate	36904292
Autoimmune Diseases	Associate	11298351, 11390436, 11675346, 12149223, 15864345, 16836768, 17463169, 18326816, 19074986, 19116909, 19155519, 19162554, 19265545, 19350181, 19701192 View all (25 more)
Autoimmune Diseases	Inhibit	15864353, 16917003, 19609102
Autoimmune Diseases	Stimulate	28747257
Autonomic Nervous System Diseases	Inhibit	25010330
Basal Ganglia Diseases	Associate	1691591
Blood Coagulation Disorders	Associate	33974229
Bone Diseases	Stimulate	31768966
Bone Resorption	Associate	17355249
Brain Injuries	Stimulate	37395036
Brain Neoplasms	Inhibit	2365829
Breast Neoplasms	Associate	12698200, 23169287, 24670917, 39214479
Bronchiolitis	Associate	24116927
Bronchiolitis Obliterans Syndrome	Associate	15327522, 17925486, 19505389, 21900196, 25266000
Bronchiolitis Obliterans Syndrome	Inhibit	15972448
Bronchiolitis Obliterans Syndrome	Stimulate	22006860
Burkitt Lymphoma	Associate	28033393
Carcinogenesis	Associate	23715268
Carcinoma	Stimulate	35558159
Carcinoma Basal Cell	Associate	21980389, 22664550
Carcinoma Endometrioid	Associate	24764580
Carcinoma Hepatocellular	Stimulate	16425355, 37798688
Carcinoma Hepatocellular	Inhibit	20883314
Carcinoma Hepatocellular	Associate	20958220, 25907075, 31903159, 32218692, 33441885
Carcinoma Intraductal Noninfiltrating	Associate	26249178
Carcinoma Non Small Cell Lung	Inhibit	21342183
Carcinoma Non Small Cell Lung	Associate	25967708, 27000869, 29959381, 37022147
Carcinoma Ovarian Epithelial	Stimulate	19673890
Carcinoma Ovarian Epithelial	Associate	34724091
Carcinoma Pancreatic Ductal	Associate	24746181, 24797069, 36281157, 40003965
Carcinoma Renal Cell	Associate	15166264, 24764580, 25089268, 26525770, 34149719
Carcinoma Transitional Cell	Associate	19623656
Cardiofaciocutaneous syndrome	Associate	7514902
Cardiomyopathy Dilated	Stimulate	27974462
Cardiomyopathy Dilated	Associate	28207945, 29566367
Cardiovascular Diseases	Associate	26293465
Cartilage Diseases	Associate	27241313
Cartilage hair hypoplasia	Associate	7554401
CD59 Deficiency	Associate	31276585
Celiac Disease	Associate	19073967, 21875375, 26405070, 34895167, 35682780
Celiac Disease	Inhibit	25465638
Central Nervous System Diseases	Stimulate	31768966
Cerebral Palsy	Associate	36195861
Chagas Cardiomyopathy	Associate	29473686
Chromosome Aberrations	Associate	9096364
Chronic Disease	Stimulate	37863732
Chronic Periodontitis	Associate	23207844
Chronobiology Disorders	Associate	27643478
Cleft Lip	Associate	25139022
Colitis	Associate	11298351, 15270855, 30227886, 34226674
Colitis Ulcerative	Stimulate	18190460, 9071939
Colitis Ulcerative	Associate	2101599, 25526204, 26333292, 28234966
Colonic Diseases	Associate	34226674
Colonic Neoplasms	Associate	22319577, 33625532
Colorectal Neoplasms	Associate	22276195, 25541970, 27619682, 33868236, 35484226
Colorectal Neoplasms	Inhibit	39456247
Common Variable Immunodeficiency	Associate	12100033, 19162554, 23432692
Conjunctivitis Allergic	Associate	24368924
Coronary Aneurysm	Associate	24419807
Coronary Artery Disease	Associate	26619243
COVID 19	Associate	32513989, 32864865, 33178221, 33751722, 34262555, 34895167, 35698744, 36925435
COVID 19	Stimulate	32950268, 33475159, 34080738
Critical Illness	Associate	31486618
Crohn Disease	Associate	16045746, 20298123, 2101599, 22128034, 25071071, 26206376, 28234966, 29453928, 29489879, 34120187
Crohn Disease	Inhibit	2004483
Crohn Disease	Stimulate	9071939
Cystic Fibrosis	Associate	14525626
Death	Associate	19703010, 24141626
Deltaretrovirus Infections	Associate	23409198
Depressive Disorder	Associate	27643478
Dermatitis Atopic	Associate	11511293, 22968402, 33901562
Dermatitis Atopic 3	Associate	1534311
Dermatitis Herpetiformis	Associate	25465638
Developmental Disabilities	Associate	36195861
Diabetes Mellitus	Associate	19116909, 21875375, 29417186, 3280182, 38408297
Diabetes Mellitus Congenital Autoimmune	Associate	38408297
Diabetes Mellitus Type 1	Associate	10762555, 11507694, 15270855, 15320890, 15776395, 17032246, 17206281, 17509149, 19037920, 19073967, 19116909, 19119414, 19125193, 19155502, 19180473 View all (36 more)
Diabetes Mellitus Type 1	Stimulate	1696864, 17100770, 28747257, 30723474, 3280182, 34350463
Diabetes Mellitus Type 1	Inhibit	27560779, 31299986, 32035746
Diabetes Mellitus Type 2	Associate	30270447
Diabetic Angiopathies	Associate	33193091
Diarrhea	Associate	30227886
DiGeorge Syndrome	Associate	21323691
Disease	Associate	12942579, 15864353
Down Syndrome	Stimulate	22861363
Drug Fever	Associate	19703010
Drug Hypersensitivity	Associate	17349011, 18832695, 19152963, 20635785, 24576111
Drug Hypersensitivity	Inhibit	22092655
Drug Hypersensitivity	Stimulate	36685514
Drug Related Side Effects and Adverse Reactions	Associate	9356333
Drug Resistant Epilepsy	Associate	27061881
Duodenal Ulcer	Associate	15618192
Dystonic Disorders	Associate	24770783
Ectrodactyly cardiopathy dysmorphism	Stimulate	29396927
Eczema	Associate	22092655, 24116927
Emanuel syndrome	Associate	29237973
Encephalitis	Associate	32109548
Enteropathy Associated T Cell Lymphoma	Associate	22654438
Eosinophilia	Associate	12672048
Eosinophilia Familial	Stimulate	14988154
Epstein Barr Virus Infections	Stimulate	23844744
Erysipelas	Associate	28512644
Esophageal Neoplasms	Associate	40587482
Fatigue Syndrome Chronic	Associate	21619669, 29867995, 33329554
Fatigue Syndrome Chronic	Inhibit	23514202
Fibrosis	Associate	20883314, 37002627
Fibrosis	Stimulate	23446058
Food Hypersensitivity	Associate	20689592
Frailty	Associate	35766906
Fused Teeth	Associate	26405070
Gastritis	Associate	22228968
Gastrointestinal Diseases	Associate	2004483
Gastrointestinal Neoplasms	Associate	12942579
GATA2 Deficiency	Stimulate	30340635
Gaucher Disease	Associate	31775513, 33193078
Genetic Diseases Inborn	Associate	38408297
Giant Cell Arteritis	Associate	22147555, 34583923
Glioblastoma	Associate	19028999, 20668009, 22383993, 24570975
Glioma	Associate	16775224, 17216339
Glomerulonephritis	Associate	8455368
Glycogen Storage Disease Type II	Associate	28389590
Graft vs Host Disease	Associate	15282533, 15327522, 16338494, 17478639, 17681668, 19505389, 19589482, 20302964, 24184334, 25450515, 28746369, 33664462, 8496391
Graft vs Host Disease	Stimulate	16792671, 28126963
Granuloma	Associate	3083688
Granulomatosis with Polyangiitis	Associate	20113371
Graves Disease	Associate	10762555, 19116909, 21815908, 33193078, 9222097
Graves Disease	Inhibit	23249428, 27206624
Graves Ophthalmopathy	Associate	27349268
Guillain Barre Syndrome	Associate	33751722
Hashimoto Disease	Inhibit	23249428, 27206624
Hashimoto Disease	Associate	33193078
Head and Neck Neoplasms	Associate	15714205
Heart Diseases	Associate	29473686
Heart Failure	Inhibit	21935395
Heart Failure	Associate	37304261
Hematologic Neoplasms	Associate	36706586
Hemolytic Uremic Syndrome	Stimulate	15730400, 19406979
Hepatitis Autoimmune	Associate	28257599, 31422415
Hepatitis B	Stimulate	23107779
Hepatitis B Chronic	Associate	34273264
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30206415, 34791787, 7923245
Hereditary leiomyomatosis and renal cell cancer	Associate	18684866, 8506943
Heredodegenerative Disorders Nervous System	Associate	15136590, 15864353
HIV Infections	Associate	11566623, 12200381, 15252446, 15271794, 15864345, 15937547, 17005693, 1735193, 17360656, 17688698, 17909079, 18484654, 18821942, 1904071, 20520721 View all (10 more)
HIV Infections	Inhibit	29048352, 8093435
HIV Seropositivity	Stimulate	1735193
Hodgkin Disease	Associate	24141626, 26438866, 8506943
HTLV I Infections	Associate	11468172, 2170270
Huntington Disease	Stimulate	34802797
Hypercalcemia	Associate	2900231
Hypereosinophilic Syndrome	Associate	1726707
Hyperplasia	Associate	24116927
Hypersensitivity Immediate	Associate	1534311
Hypertension Pregnancy Induced	Inhibit	29846432
Hyperthyroidism	Stimulate	9222097
Hypomagnesemia 5 Renal with Ocular Involvement	Associate	19377213, 24774748
Idiopathic Pulmonary Fibrosis	Associate	14680494, 33925174
Idiopathic Pulmonary Fibrosis	Inhibit	21309737
IgA Deficiency	Stimulate	7489939
Iliac Aneurysm	Associate	34392384
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome	Associate	15270855, 19155519, 38117899
Immune System Diseases	Associate	12942579, 17688698, 2101599, 27706780
Immunologic Deficiency Syndromes	Associate	23416241, 24116927, 9096364
Infections	Associate	15618192, 18827929, 24116927, 7632951, 9203962
Infections	Inhibit	28199704
Infectious Mononucleosis	Associate	1628427
Infectious Mononucleosis	Stimulate	34101867
Inflammation	Associate	10504456, 11468172, 12672048, 1334945, 1534311, 18684844, 19152963, 19956753, 22307621, 22855463, 23409198, 23416241, 26448050, 27416040, 28284938 View all (13 more)
Inflammatory Bowel Diseases	Associate	18330941, 18422560, 21376048, 34226674
Influenza Human	Stimulate	20483407
Influenza Human	Associate	21966414
Intestinal Diseases	Associate	22228968
Kidney Diseases	Inhibit	20977632
Kidney Diseases	Associate	31535918, 36164371, 8455368
Kidney Failure Chronic	Associate	24189710
Latent Tuberculosis	Associate	25528189
Lead Poisoning Nervous System	Associate	12672048
Leishmaniasis	Associate	25139022
Leishmaniasis Cutaneous	Associate	25139022
Leprosy	Associate	24214631, 25672298, 29883464, 30540075
Leprosy Lepromatous	Associate	24214631, 24454972
Leprosy Paucibacillary	Associate	30540075
Leprosy Tuberculoid	Associate	24214631
Leukemia	Stimulate	12010811, 20801903
Leukemia	Associate	15811959, 17681668, 18510697, 19638467, 20063526, 20113470, 25006129, 2503474, 2787681, 28097942, 2833327, 28978570, 2900231, 2993359, 3098894 View all (6 more)
Leukemia	Inhibit	30696068
Leukemia Acute X Linked	Associate	22875869
Leukemia Hairy Cell	Associate	11079033, 24903677, 29110361, 31077558, 32132867, 34710243, 38440808, 6192435, 8329708, 8537498, 8602628
Leukemia Large Granular Lymphocytic	Associate	2146981, 2833327
Leukemia Lymphocytic Chronic B Cell	Associate	10812246, 11830482, 12010811, 16517754, 1976463, 20081380, 20544350, 29893517, 3135858, 3496927, 7994039, 8286829, 8602628
Leukemia Lymphocytic Chronic B Cell	Inhibit	11298591
Leukemia Lymphoma Adult T Cell	Associate	1373087, 14592824, 15198736, 1527057, 16108835, 1675581, 17970785, 18510697, 19864230, 20448385, 2367534, 2713499, 28978570, 2900231, 2993359 View all (5 more)
Leukemia Lymphoma Adult T Cell	Stimulate	1398748, 3098894
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23383287, 2787681, 28122740
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	23651669, 37895120
Leukemia Myeloid Acute	Associate	10354136, 22855599, 24881741, 25006129, 26375984, 28097942, 29720577, 29843224, 29922294, 3115340, 31171000, 32417762, 32456622, 3316474, 33284559 View all (8 more)
Leukemia Myelomonocytic Chronic	Associate	30026572
Leukemia Prolymphocytic T Cell	Associate	19751240, 21985361
Leukemia T Cell	Associate	9203962
Leukocyte adhesion deficiency type 1	Associate	36657813
Leukocytosis	Associate	26375984
Light Fixation Seizure Syndrome	Inhibit	10098769
Liposarcoma Myxoid	Stimulate	35558159
Liver Cirrhosis	Associate	28922436, 34273264
Liver Cirrhosis	Stimulate	31069827
Liver Cirrhosis Biliary	Associate	16584111, 23681290, 24116927
Liver Diseases	Associate	16425355, 25953611
Liver Failure Acute	Associate	29229400
Lung Diseases	Associate	24116927
Lung Diseases Interstitial	Associate	8506752
Lung Neoplasms	Associate	11970966, 18064389, 31066485, 37307368, 7829125, 8506752
Lung Neoplasms	Inhibit	15048152, 28187172
Lung Neoplasms	Stimulate	28253320
Lupus Erythematosus Cutaneous	Associate	17530636
Lupus Erythematosus Systemic	Stimulate	14872508, 18800986, 22585674, 24774748, 31354747
Lupus Erythematosus Systemic	Inhibit	16423064, 18505426, 18576316, 28542701, 28747257, 32718891
Lupus Erythematosus Systemic	Associate	16606650, 17257224, 17277168, 17587349, 19155519, 19265545, 19377213, 19841178, 20178125, 20370571, 21708033, 22479496, 22506043, 23913957, 26582197 View all (7 more)
Lupus Nephritis	Associate	1405353, 24475019, 24774748, 27156107
Lupus Nephritis	Stimulate	19377213
Lyme Disease	Associate	23450683
Lymphatic Metastasis	Associate	23826668, 40587482
Lymphohistiocytosis Hemophagocytic	Associate	26903364
Lymphoma	Associate	10823948, 12149223, 15940674, 17615291, 2305833, 24236041, 24369221, 25297818, 26464657, 2900231, 30378727
Lymphoma	Inhibit	2174895
Lymphoma B Cell	Associate	10540330, 1325025, 20518821, 21719603, 22174855, 24236041, 26448050, 26464657, 3024885
Lymphoma Follicular	Associate	22015774, 22981118
Lymphoma Large B Cell Diffuse	Associate	22981118, 24236041, 24369221, 31768966, 39386202
Lymphoma Large Cell Anaplastic	Associate	15205267, 1675581, 19864230, 30206415
Lymphoma Non Hodgkin	Associate	17615291, 20518821
Lymphoma Primary Cutaneous Anaplastic Large Cell	Associate	26458652
Lymphoma T Cell	Associate	1373087, 28431200, 34867966, 6192435
Lymphoma T Cell	Inhibit	26022711
Lymphoma T Cell Cutaneous	Associate	15514008, 16410787, 19505389, 19626037, 22738414, 25779945, 31742861
Lymphoma T Cell Peripheral	Associate	34111312
Lymphopenia	Associate	22383993
Lymphoproliferative Disorders	Associate	12766168, 2146981
Malaria Cerebral	Inhibit	32801995
Mast Cell Activation Disorders	Associate	15166264, 21186345, 26525770, 29043985
Mastocytosis Systemic	Associate	12588358, 17662084, 19581658, 21186345, 22025884, 22222639, 26525770, 29223146, 30696068, 36982353, 9531582
Melanoma	Associate	15471828, 19651643, 23284620, 33820810, 34159752, 40558528
Meningeal Carcinomatosis	Associate	3265403
Mesothelioma Malignant	Associate	19309551
Milk Hypersensitivity	Stimulate	12138061
Mitochondrial Diseases	Associate	31742861
Monoclonal Gammopathy of Undetermined Significance	Stimulate	16150935
Mouth Diseases	Associate	2101599
Mucocutaneous Lymph Node Syndrome	Associate	26619243, 34093549
Mucocutaneous Lymph Node Syndrome	Stimulate	9790317
Multiple Myeloma	Associate	16150935, 18071334, 1832993, 22666318, 23232072, 28249894
Multiple Sclerosis	Associate	17660530, 18727631, 18769633, 19116909, 19119414, 19125193, 19155502, 19237575, 19265545, 19364932, 19701192, 20179739, 20370571, 21067621, 21300823 View all (28 more)
Multiple Sclerosis	Inhibit	19016907, 21731726
Multiple Sclerosis Chronic Progressive	Associate	24770783
Myasthenia Gravis	Associate	10593570, 15454488, 23110942, 26347149, 39740367
Myasthenia Gravis Autoimmune Experimental	Associate	15454488
Mycosis Fungoides	Associate	22738414, 25779945
Myelodysplastic Syndromes	Stimulate	28097942
Myelodysplastic Syndromes	Associate	2955819, 34543390
Myocardial Infarction	Associate	23330016
Myositis	Associate	9008283
Myositis Inclusion Body	Associate	24594700
Narcolepsy 1	Associate	28107375
Nasopharyngeal Carcinoma	Associate	17262084, 19220831
Neoplasm Metastasis	Associate	29975213, 34159752
Neoplasm Residual	Associate	36332294
Neoplasms	Associate	10555752, 11418694, 12797908, 1373087, 14635058, 15315967, 15618192, 16362412, 16522817, 16836768, 17216339, 17508019, 18814264, 19902430, 21118979 View all (44 more)
Neoplasms	Stimulate	24512329, 26964534, 28097942, 9731051
Neoplasms	Inhibit	29791021
Neoplasms Unknown Primary	Associate	35074904
Nephritis	Stimulate	19377213
Nephritis	Associate	24774748
Nephrosis congenital	Associate	21762125
Nervous System Diseases	Associate	2367534, 26329520
Neuroblastoma	Associate	19638467, 28687069
Neuromyelitis Optica	Associate	38539091
Obesity	Stimulate	22228716
Obesity	Inhibit	23857381
Obesity	Associate	28963085
Osteoarthritis	Associate	27044824
Osteomyelitis	Associate	32954739
Ovarian Neoplasms	Associate	19673890, 24244610, 24764580, 35186171, 36837407
Ovarian Neoplasms	Stimulate	26166762
Overweight	Associate	28963085
Pancreatic Neoplasms	Associate	40558528
Pancreatitis	Stimulate	40003965
Pancreatitis Chronic	Associate	24797069
Papilloma	Associate	22322668
Paralysis	Associate	33178221
Paraparesis Tropical Spastic	Associate	1549569, 15864345, 18326816, 18664281, 24845974
Paraparesis Tropical Spastic	Stimulate	23409198, 2367534, 8052162
Paraplegia	Associate	24881741
Parkinson Disease	Associate	19505389
Pemphigoid Bullous	Inhibit	22310732
Pemphigus	Associate	31211854
Peptic Ulcer	Stimulate	22228968
Periodontal Diseases	Associate	17355249, 23207844
Peritonitis	Associate	12942579
Persistent Infection	Associate	34350463
Philadelphia Chromosome	Associate	25337274
Pleural Effusion	Associate	1371640, 24134738
Pleural Effusion Malignant	Associate	29785404
Polycythemia Vera	Associate	35025147
Post Acute COVID 19 Syndrome	Associate	27560779
Prader Willi Syndrome	Associate	37251380
Pre Eclampsia	Associate	12623476, 22837649
Pre Eclampsia	Stimulate	37921073
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	20063526, 25802479
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	1672098, 20063526, 21365622, 25337274, 2822168, 29237973, 7519476, 7664187
Precursor Cell Lymphoblastic Leukemia Lymphoma	Inhibit	9111583
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Stimulate	19388935
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24115371, 7519476
Primary Immunodeficiency Diseases	Associate	31040184, 38644452
Primary Myelofibrosis	Associate	22081434
Prostatic Neoplasms	Associate	22647697, 37108754
Prostatic Neoplasms Castration Resistant	Associate	23319273
Proteinuria	Associate	11786088, 24774748
Psoriasis	Associate	25568543
Pulmonary Disease Chronic Obstructive	Associate	18684844, 21651772, 28963085, 30842769, 31440043, 37307368
Pulmonary Edema	Associate	25010330
Pulmonary Fibrosis	Associate	8506752
Purpura Thrombocytopenic Idiopathic	Associate	18519809, 19056692, 23215839, 24338252, 31273052, 32419211, 34445858
Pyruvate Carboxylase Deficiency Disease	Associate	1929608
Quadriplegia	Associate	36195861
Rectal Neoplasms	Associate	25541970
Renal Insufficiency	Inhibit	27191978
Respiratory Distress Syndrome	Associate	34163488
Rheumatic Diseases	Associate	17257224
Rhinitis	Associate	10543283
Rhinitis Allergic	Associate	17349011, 18797179, 23454781, 31598989
Ring Chromosome 20 Syndrome	Stimulate	31768966
Sarcoidosis	Associate	22984568, 37863732
Sarcoidosis Pulmonary	Associate	3083688
Sarcoma Myeloid	Associate	24881741
Severe Acute Respiratory Syndrome	Stimulate	32217835
Severe Combined Immunodeficiency	Associate	24116927, 7554401
Sezary Syndrome	Associate	19626037, 22738414, 25779945
Silicosis	Associate	21244759
Sjogren's Syndrome	Associate	26436101, 37353767, 7578884
Skin Diseases	Associate	10504456, 24335103
Skin Neoplasms	Associate	35018451
Small Cell Lung Carcinoma	Associate	1319985
Smoldering Multiple Myeloma	Inhibit	26668134
Spinal Cord Diseases	Associate	15864353, 20945034
Spondylitis Ankylosing	Associate	16180249, 20722024
Squamous Cell Carcinoma of Head and Neck	Associate	18547033, 18559587, 22252752, 22252753, 23826668, 25153698, 31662531, 39437531
Status Asthmaticus	Associate	12061423, 16883065, 23893806, 31685437, 33400919
Status Asthmaticus	Inhibit	23857381
Still's Disease Adult Onset	Associate	34319596
Stomach Neoplasms	Associate	12942579, 2522349, 30988066, 34968167
Stomach Neoplasms	Stimulate	15618192, 22228968
Stress Disorders Post Traumatic	Associate	27643478
Stroke	Stimulate	20090932
Syndrome	Associate	30947425
Systemic Vasculitis	Associate	19265545
Tachycardia Atrioventricular Nodal Reentry	Stimulate	23826668
Tertiary Lymphoid Structures	Associate	26708831
Thyroid Cancer Papillary	Associate	31159823, 32348468
Thyroid Carcinoma Anaplastic	Associate	36328145
Thyroid Diseases	Associate	23249428, 33193078
Thyroid Neoplasms	Associate	36328145
Thyroiditis Autoimmune	Inhibit	16698664, 23249428
Thyroiditis Autoimmune	Associate	27206624, 33193078
Toxoplasmosis Ocular	Associate	21225130
Tuberculosis	Associate	19438599, 22431997, 25528189, 25887604, 33008839, 37460564, 37809012
Tuberculosis	Stimulate	21303360, 29489879
Tuberculosis Meningeal	Inhibit	15708307
Tuberculosis Meningeal	Associate	23826366
Tuberculosis Multidrug Resistant	Inhibit	20655262
Tuberculosis Pleural	Associate	24134738, 37809012
Tuberculosis Pulmonary	Associate	25528189, 28881482, 29472922
Ureteral Neoplasms	Associate	29243545
Urinary Bladder Neoplasms	Associate	26824503, 26862849, 32484812
Uterine Cervical Neoplasms	Associate	17937675, 32518078
Uterine Cervical Neoplasms	Stimulate	23587428
Uveitis	Associate	7882564
Uveitis Anterior	Stimulate	15043537
Uveitis Intermediate	Associate	26133380, 33326162
Vasculitis	Associate	34950150
Virus Diseases	Associate	24116927
Vitiligo	Associate	20410501, 22951725
Vulvar Lichen Sclerosus	Associate	33438816
X Linked Combined Immunodeficiency Diseases	Associate	15129596

IL2RA (interleukin 2 receptor subunit alpha)