Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3556
Gene name Gene Name - the full gene name approved by the HGNC.	Interleukin 1 receptor accessory protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IL1RAP
Synonyms (NCBI Gene) Gene synonyms aliases	C3orf13, IL-1RAcP, IL1R3
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q28
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differ

Show/Hide all(177)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005831	hsa-miR-204-5p	Microarray	21282569
MIRT020058	hsa-miR-375	Microarray	20215506
MIRT024630	hsa-miR-215-5p	Microarray	19074876
MIRT026944	hsa-miR-192-5p	Microarray	19074876
MIRT036392	hsa-miR-1228-3p	CLASH	23622248
MIRT437619	hsa-miR-146a-5p	Microarray, qRT-PCR	22815788
MIRT437625	hsa-miR-146b-5p	Microarray, qRT-PCR	22815788
MIRT448179	hsa-miR-548c-3p	PAR-CLIP	22291592
MIRT448178	hsa-miR-4635	PAR-CLIP	22291592
MIRT448177	hsa-miR-494-3p	PAR-CLIP	22291592
MIRT448176	hsa-miR-510-3p	PAR-CLIP	22291592
MIRT448179	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT448178	hsa-miR-4635	PAR-CLIP	22100165
MIRT448177	hsa-miR-494-3p	PAR-CLIP	22100165
MIRT448176	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT448179	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT448178	hsa-miR-4635	PAR-CLIP	22100165
MIRT448177	hsa-miR-494-3p	PAR-CLIP	22100165
MIRT448176	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT448179	hsa-miR-548c-3p	PAR-CLIP	22291592
MIRT448178	hsa-miR-4635	PAR-CLIP	22291592
MIRT448177	hsa-miR-494-3p	PAR-CLIP	22291592
MIRT448176	hsa-miR-510-3p	PAR-CLIP	22291592
MIRT448179	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT448178	hsa-miR-4635	PAR-CLIP	22100165
MIRT448177	hsa-miR-494-3p	PAR-CLIP	22100165
MIRT448176	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT448179	hsa-miR-548c-3p	PAR-CLIP	22100165
MIRT448178	hsa-miR-4635	PAR-CLIP	22100165
MIRT448177	hsa-miR-494-3p	PAR-CLIP	22100165
MIRT448176	hsa-miR-510-3p	PAR-CLIP	22100165
MIRT1064296	hsa-miR-1206	CLIP-seq
MIRT1064297	hsa-miR-1261	CLIP-seq
MIRT1064298	hsa-miR-1270	CLIP-seq
MIRT1064299	hsa-miR-1290	CLIP-seq
MIRT1064300	hsa-miR-141	CLIP-seq
MIRT1064301	hsa-miR-181a	CLIP-seq
MIRT1064302	hsa-miR-181b	CLIP-seq
MIRT1064303	hsa-miR-181c	CLIP-seq
MIRT1064304	hsa-miR-181d	CLIP-seq
MIRT1064305	hsa-miR-192	CLIP-seq
MIRT1064306	hsa-miR-194	CLIP-seq
MIRT1064307	hsa-miR-200a	CLIP-seq
MIRT1064308	hsa-miR-208a	CLIP-seq
MIRT1064309	hsa-miR-208b	CLIP-seq
MIRT1064310	hsa-miR-21	CLIP-seq
MIRT1064311	hsa-miR-215	CLIP-seq
MIRT1064312	hsa-miR-23a	CLIP-seq
MIRT1064313	hsa-miR-23b	CLIP-seq
MIRT1064314	hsa-miR-23c	CLIP-seq
MIRT1064315	hsa-miR-27a	CLIP-seq
MIRT1064316	hsa-miR-27b	CLIP-seq
MIRT1064317	hsa-miR-299-3p	CLIP-seq
MIRT1064318	hsa-miR-3143	CLIP-seq
MIRT1064319	hsa-miR-3158-3p	CLIP-seq
MIRT1064320	hsa-miR-3163	CLIP-seq
MIRT1064321	hsa-miR-3167	CLIP-seq
MIRT1064322	hsa-miR-346	CLIP-seq
MIRT1064323	hsa-miR-34b	CLIP-seq
MIRT1064324	hsa-miR-3607-5p	CLIP-seq
MIRT1064325	hsa-miR-3661	CLIP-seq
MIRT1064326	hsa-miR-3691-5p	CLIP-seq
MIRT1064327	hsa-miR-3924	CLIP-seq
MIRT1064328	hsa-miR-3940-5p	CLIP-seq
MIRT1064329	hsa-miR-3976	CLIP-seq
MIRT1064330	hsa-miR-4262	CLIP-seq
MIRT1064331	hsa-miR-4263	CLIP-seq
MIRT1064332	hsa-miR-4288	CLIP-seq
MIRT1064333	hsa-miR-4432	CLIP-seq
MIRT1064334	hsa-miR-4491	CLIP-seq
MIRT1064335	hsa-miR-4507	CLIP-seq
MIRT1064336	hsa-miR-451b	CLIP-seq
MIRT1064337	hsa-miR-4646-5p	CLIP-seq
MIRT1064338	hsa-miR-4652-3p	CLIP-seq
MIRT1064339	hsa-miR-4655-5p	CLIP-seq
MIRT1064340	hsa-miR-4657	CLIP-seq
MIRT1064341	hsa-miR-4662a-3p	CLIP-seq
MIRT1064342	hsa-miR-4666-5p	CLIP-seq
MIRT1064343	hsa-miR-4683	CLIP-seq
MIRT1064344	hsa-miR-4711-3p	CLIP-seq
MIRT1064345	hsa-miR-4729	CLIP-seq
MIRT1064346	hsa-miR-4731-5p	CLIP-seq
MIRT1064347	hsa-miR-4752	CLIP-seq
MIRT1064348	hsa-miR-4766-3p	CLIP-seq
MIRT1064349	hsa-miR-4778-5p	CLIP-seq
MIRT1064350	hsa-miR-4789-5p	CLIP-seq
MIRT1064351	hsa-miR-4799-5p	CLIP-seq
MIRT1064352	hsa-miR-4803	CLIP-seq
MIRT1064353	hsa-miR-499-5p	CLIP-seq
MIRT1064354	hsa-miR-513a-5p	CLIP-seq
MIRT1064355	hsa-miR-539	CLIP-seq
MIRT1064356	hsa-miR-543	CLIP-seq
MIRT1064357	hsa-miR-548ac	CLIP-seq
MIRT1064358	hsa-miR-548ad	CLIP-seq
MIRT1064359	hsa-miR-548ae	CLIP-seq
MIRT1064360	hsa-miR-548aj	CLIP-seq
MIRT1064361	hsa-miR-548am	CLIP-seq
MIRT1064362	hsa-miR-548d-3p	CLIP-seq
MIRT1064363	hsa-miR-548x	CLIP-seq
MIRT1064364	hsa-miR-548z	CLIP-seq
MIRT1064365	hsa-miR-563	CLIP-seq
MIRT1064366	hsa-miR-568	CLIP-seq
MIRT1064367	hsa-miR-576-5p	CLIP-seq
MIRT1064368	hsa-miR-579	CLIP-seq
MIRT1064369	hsa-miR-582-5p	CLIP-seq
MIRT1064370	hsa-miR-590-5p	CLIP-seq
MIRT1064371	hsa-miR-620	CLIP-seq
MIRT1064372	hsa-miR-631	CLIP-seq
MIRT1064373	hsa-miR-632	CLIP-seq
MIRT1064374	hsa-miR-664	CLIP-seq
MIRT1064375	hsa-miR-876-5p	CLIP-seq
MIRT1064376	hsa-miR-1249	CLIP-seq
MIRT1064308	hsa-miR-208a	CLIP-seq
MIRT1064309	hsa-miR-208b	CLIP-seq
MIRT1064377	hsa-miR-3065-5p	CLIP-seq
MIRT1064318	hsa-miR-3143	CLIP-seq
MIRT1064378	hsa-miR-3149	CLIP-seq
MIRT1064379	hsa-miR-34c-3p	CLIP-seq
MIRT1064380	hsa-miR-3616-5p	CLIP-seq
MIRT1064381	hsa-miR-3647-5p	CLIP-seq
MIRT1064382	hsa-miR-3663-3p	CLIP-seq
MIRT1064383	hsa-miR-3671	CLIP-seq
MIRT1064327	hsa-miR-3924	CLIP-seq
MIRT1064384	hsa-miR-421	CLIP-seq
MIRT1064385	hsa-miR-4275	CLIP-seq
MIRT1064386	hsa-miR-4307	CLIP-seq
MIRT1064333	hsa-miR-4432	CLIP-seq
MIRT1064336	hsa-miR-451b	CLIP-seq
MIRT1064387	hsa-miR-4666-3p	CLIP-seq
MIRT1064342	hsa-miR-4666-5p	CLIP-seq
MIRT1064388	hsa-miR-4709-5p	CLIP-seq
MIRT1064389	hsa-miR-4795-5p	CLIP-seq
MIRT1064352	hsa-miR-4803	CLIP-seq
MIRT1064390	hsa-miR-494	CLIP-seq
MIRT1064353	hsa-miR-499-5p	CLIP-seq
MIRT1064358	hsa-miR-548ad	CLIP-seq
MIRT1064366	hsa-miR-568	CLIP-seq
MIRT1064391	hsa-miR-573	CLIP-seq
MIRT1064392	hsa-miR-607	CLIP-seq
MIRT1064393	hsa-miR-935	CLIP-seq
MIRT1064394	hsa-miR-4292	CLIP-seq
MIRT1064395	hsa-miR-4308	CLIP-seq
MIRT1064337	hsa-miR-4646-5p	CLIP-seq
MIRT1550105	hsa-miR-29a	CLIP-seq
MIRT1550106	hsa-miR-29b	CLIP-seq
MIRT1550107	hsa-miR-29c	CLIP-seq
MIRT1550108	hsa-miR-3183	CLIP-seq
MIRT1550109	hsa-miR-4266	CLIP-seq
MIRT1550110	hsa-miR-4469	CLIP-seq
MIRT1550111	hsa-miR-4723-3p	CLIP-seq
MIRT1550112	hsa-miR-4777-3p	CLIP-seq
MIRT1550113	hsa-miR-642a	CLIP-seq
MIRT1550114	hsa-miR-767-5p	CLIP-seq
MIRT1064323	hsa-miR-34b	CLIP-seq
MIRT2247647	hsa-miR-1245b-5p	CLIP-seq
MIRT2247648	hsa-miR-1303	CLIP-seq
MIRT2247649	hsa-miR-3142	CLIP-seq
MIRT2247650	hsa-miR-3182	CLIP-seq
MIRT2247651	hsa-miR-4303	CLIP-seq
MIRT2247652	hsa-miR-4649-3p	CLIP-seq
MIRT2247653	hsa-miR-877	CLIP-seq
MIRT2551056	hsa-miR-1208	CLIP-seq
MIRT2551057	hsa-miR-221	CLIP-seq
MIRT2551058	hsa-miR-222	CLIP-seq
MIRT2551059	hsa-miR-3680	CLIP-seq
MIRT1064344	hsa-miR-4711-3p	CLIP-seq
MIRT2551060	hsa-miR-4798-3p	CLIP-seq
MIRT2551061	hsa-miR-592	CLIP-seq
MIRT2551062	hsa-miR-599	CLIP-seq
MIRT2551056	hsa-miR-1208	CLIP-seq
MIRT2551057	hsa-miR-221	CLIP-seq
MIRT2551058	hsa-miR-222	CLIP-seq
MIRT2551059	hsa-miR-3680	CLIP-seq
MIRT1064344	hsa-miR-4711-3p	CLIP-seq
MIRT2551060	hsa-miR-4798-3p	CLIP-seq
MIRT2551061	hsa-miR-592	CLIP-seq
MIRT2551062	hsa-miR-599	CLIP-seq

Show/Hide all(26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002114	Function	Interleukin-33 receptor activity	IEA
GO:0004908	Function	Interleukin-1 receptor activity	IBA	21873635
GO:0005149	Function	Interleukin-1 receptor binding	IBA	21873635
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	TAS	7775431
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	9065432
GO:0016020	Component	Membrane	HDA	19946888
GO:0019221	Process	Cytokine-mediated signaling pathway	TAS
GO:0032736	Process	Positive regulation of interleukin-13 production	IEA
GO:0032754	Process	Positive regulation of interleukin-5 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0038172	Process	Interleukin-33-mediated signaling pathway	TAS
GO:0045087	Process	Innate immune response	IEA
GO:0050135	Function	NAD(P)+ nucleosidase activity	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IBA	21873635
GO:0051965	Process	Positive regulation of synapse assembly	ISS
GO:0061809	Function	NAD+ nucleotidase, cyclic ADP-ribose generating	IEA
GO:0065003	Process	Protein-containing complex assembly	TAS	7775431
GO:0070498	Process	Interleukin-1-mediated signaling pathway	TAS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099151	Process	Regulation of postsynaptic density assembly	IEA
GO:0099545	Process	Trans-synaptic signaling by trans-synaptic complex	IEA
GO:0099560	Process	Synaptic membrane adhesion	IEA
GO:1905606	Process	Regulation of presynapse assembly	IEA

MIM	HGNC	e!Ensembl
602626	5995	ENSG00000196083

Protein

UniProt ID

Q9NPH3

Protein name

Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-1 receptor 3) (IL-1R-3) (IL-1R3)

Protein function

Coreceptor for IL1RL2 in the IL-36 signaling system (By similarity). Coreceptor with IL1R1 in the IL-1 signaling system. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-de

PDB

3O4O , 4DEP , 7FCC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF18452	Ig_6	88 → 137	Immunoglobulin domain	Domain
PF13927	Ig_3	242 → 336		Domain
PF01582	TIR	404 → 570	TIR domain	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in liver, skin, placenta, thymus and lung. Isoform 4 is predominantly expressed in brain. Overexpressed on candidate chronic myeloid leukemia (CML) stem cells, hematopoietic stem cells and mononuclear cells of patients with ac

Sequence

MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV

Sequence length

570

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Cytokine-cytokine receptor interaction Th17 cell differentiation Inflammatory mediator regulation of TRP channels		PIP3 activates AKT signaling Receptor-type tyrosine-protein phosphatases PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Interleukin-36 pathway Interleukin-33 signaling Interleukin-1 signaling

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma of the head and neck	Squamous cell carcinoma of the head and neck	rs121909237, rs121909250, rs121909251, rs121909252, rs28934571, rs28934574, rs28934576, rs28934578, rs121912664, rs397516436, rs121912666, rs397514495, rs587782705, rs193920774, rs730882001 View all (7 more)	27738319

Show/Hide Text Mining Associations (34)

Disease Name	Relationship Type	References
Associations from Text Mining
AA amyloidosis	Associate	26268530
Alzheimer Disease	Associate	26268530, 30792413, 33522999, 34654853
Arthritis Rheumatoid	Associate	25016825, 31376255
Arthritis Rheumatoid	Stimulate	31396542
Asthma	Associate	35986608
Atrophy	Associate	26268530
Bipolar Disorder	Associate	36351892
Brain Diseases	Associate	33522999
Carcinoma Merkel Cell	Associate	35409061
Carcinoma Pancreatic Ductal	Associate	35395492
Cognition Disorders	Associate	26268530, 30792413
Colorectal Neoplasms	Associate	34083590
Complex Regional Pain Syndromes	Associate	31217010
Drug Related Side Effects and Adverse Reactions	Associate	20805474
Essential Hypertension	Associate	40075282
Fibromyalgia	Associate	32704114
Graft vs Host Disease	Associate	32492155
Inflammation	Associate	21048961, 24915116, 33121233
Leukemia	Associate	22723552, 33121233, 34138728
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	20805474
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	23479569, 23651669, 28122740
Leukemia Myeloid Acute	Associate	22723552, 23479569, 33121233, 34138728, 34543390, 39582863
Lung Neoplasms	Stimulate	34475499
Macular Degeneration	Associate	32871771
Myelodysplastic Syndromes	Associate	22723552, 34543390
Neoplasm Metastasis	Associate	34021002
Neoplasms	Associate	24297791, 35409061, 36036818
Obesity	Associate	24915116
Parkinson Disease	Stimulate	38485911
Philadelphia Chromosome	Associate	20805474
Pulmonary Disease Chronic Obstructive	Associate	25595648
Sarcoma	Associate	34021002
Sarcoma Ewing	Associate	34021002
Thrombosis	Associate	32203583

IL1RAP (interleukin 1 receptor accessory protein)