Gene Gene information from NCBI Gene database.
Entrez ID 3556
Gene name Interleukin 1 receptor accessory protein
Gene symbol IL1RAP
Synonyms (NCBI Gene)
C3orf13IL-1RAcPIL1R3
Chromosome 3
Chromosome location 3q28
Summary This gene encodes a component of the interleukin 1 receptor complex, which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in membrane-bound and soluble isoforms differ
miRNA miRNA information provided by mirtarbase database.
177
miRTarBase ID miRNA Experiments Reference
MIRT005831 hsa-miR-204-5p Microarray 21282569
MIRT020058 hsa-miR-375 Microarray 20215506
MIRT024630 hsa-miR-215-5p Microarray 19074876
MIRT026944 hsa-miR-192-5p Microarray 19074876
MIRT036392 hsa-miR-1228-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
43
GO ID Ontology Definition Evidence Reference
GO:0002114 Function Interleukin-33 receptor activity IEA
GO:0002376 Process Immune system process IEA
GO:0004908 Function Interleukin-1 receptor activity IBA
GO:0004908 Function Interleukin-1 receptor activity IEA
GO:0005576 Component Extracellular region IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602626 5995 ENSG00000196083
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NPH3
Protein name Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-1 receptor 3) (IL-1R-3) (IL-1R3)
Protein function Coreceptor for IL1RL2 in the IL-36 signaling system (By similarity). Coreceptor with IL1R1 in the IL-1 signaling system. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-de
PDB 3O4O , 4DEP , 7FCC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18452 Ig_6 88 137 Immunoglobulin domain Domain
PF13927 Ig_3 242 336 Domain
PF01582 TIR 404 570 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Detected in liver, skin, placenta, thymus and lung. Isoform 4 is predominantly expressed in brain. Overexpressed on candidate chronic myeloid leukemia (CML) stem cells, hematopoietic stem cells and mononuclear cells of patients with ac
Sequence
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSC
FNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARS
AKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV
Sequence length 570
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Cytokine-cytokine receptor interaction
Th17 cell differentiation
Inflammatory mediator regulation of TRP channels
  PIP3 activates AKT signaling
Receptor-type tyrosine-protein phosphatases
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
Interleukin-36 pathway
Interleukin-33 signaling
Interleukin-1 signaling
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
High myopia Uncertain significance rs145613403 RCV000785706
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
AA amyloidosis Associate 26268530
Alzheimer Disease Associate 26268530, 30792413, 33522999, 34654853
Arthritis Rheumatoid Associate 25016825, 31376255
Arthritis Rheumatoid Stimulate 31396542
Asthma Associate 35986608
Atrophy Associate 26268530
Bipolar Disorder Associate 36351892
Brain Diseases Associate 33522999
Carcinoma Merkel Cell Associate 35409061
Carcinoma Pancreatic Ductal Associate 35395492