Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3554
Gene name Gene Name - the full gene name approved by the HGNC.
Interleukin 1 receptor type 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
IL1R1
Synonyms (NCBI Gene) Gene synonyms aliases
CD121A, CRMO3, D2S1473, IL-1R-alpha, IL-1RT1, IL1R, IL1RA, P80
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q11.2-q12.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a cytokine receptor that belongs to the interleukin-1 receptor family. The encoded protein is a receptor for interleukin-1 alpha, interleukin-1 beta, and interleukin-1 receptor antagonist. It is an important mediator involved in many cyt
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT004217 hsa-miR-197-3p Microarray 16822819
MIRT023115 hsa-miR-124-3p Microarray 18668037
MIRT024405 hsa-miR-215-5p Microarray 19074876
MIRT026961 hsa-miR-192-5p Microarray 19074876
MIRT733021 hsa-miR-636 ELISA, Luciferase reporter assay, qRT-PCR, Western blotting 31803183
Transcription factors
Transcription factor Regulation Reference
STAT1 Unknown 15972639
STAT6 Activation 8757327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002020 Function Protease binding IEA
GO:0004888 Function Transmembrane signaling receptor activity TAS 2530587
GO:0004896 Function Cytokine receptor activity IEA
GO:0004908 Function Interleukin-1 receptor activity IBA
GO:0004908 Function Interleukin-1 receptor activity IDA 2950091, 10383454
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147810 5993 ENSG00000115594
Protein
UniProt ID P14778
Protein name Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor typ
Protein function Receptor for IL1A, IL1B and IL1RN (PubMed:2950091, PubMed:37315560). After binding to interleukin-1 associates with the coreceptor IL1RAP to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation
PDB 1G0Y , 1IRA , 1ITB , 4DEP , 4GAF
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF18452 Ig_6 70 117 Immunoglobulin domain Domain
PF13895 Ig_2 121 213 Immunoglobulin domain Domain
PF01582 TIR 387 564 TIR domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in T-helper cell subsets. Preferentially expressed in T-helper 1 (Th1) cells. {ECO:0000269|PubMed:10653850}.
Sequence
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVI
EFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREA
HVPLG
Sequence length 569
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  MAPK signaling pathway
Cytokine-cytokine receptor interaction
NF-kappa B signaling pathway
Osteoclast differentiation
Hematopoietic cell lineage
Th17 cell differentiation
Inflammatory mediator regulation of TRP channels
Pathogenic Escherichia coli infection
Shigellosis
Amoebiasis
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Fluid shear stress and atherosclerosis
  Interleukin-10 signaling
Interleukin-1 signaling
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Ankylosing Spondylitis Ankylosing spondylitis N/A N/A GWAS
Asthma Asthma (childhood onset), Nonatopic asthma, Asthma onset (childhood vs adult), Asthma in any disease, Asthma N/A N/A GWAS
Crohn Disease Crohn's disease N/A N/A GWAS
Dermatitis Atopic dermatitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 35328735
Age Related Hearing Impairment 1 Associate 32252823
Allan Herndon Dudley syndrome Associate 37253337
Alzheimer Disease Associate 23186989, 31018751, 37061663
Anhedonia Associate 37932834
Asthma Associate 25895113, 28223794
Asthma Stimulate 37809092
Atherosclerosis Stimulate 19574724
Atherosclerosis Associate 21698167
Barrett Esophagus Associate 35328735