IK (IK cytokine)

Gene

• Entrez ID: 3550
• Gene name: IK cytokine
• Gene symbol: IK
• Synonyms (NCBI Gene): CSA2, RED, RER
• Chromosome: 5
• Chromosome location: 5q31.3
• Summary: The protein encoded by this gene was identified by its RED repeat, a stretch of repeated arginine, glutamic acid and aspartic acid residues. The protein localizes to discrete dots within the nucleus, excluding the nucleolus. Its function is unknown. This

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025539	hsa-miR-34a-5p	Proteomics	21566225
MIRT048953	hsa-miR-92a-3p	CLASH	23622248
MIRT040554	hsa-miR-92b-3p	CLASH	23622248
MIRT2247169	hsa-miR-3674	CLIP-seq
MIRT2247170	hsa-miR-3978	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000228	Component	Nuclear chromosome	IMP	24252166
GO:0000278	Process	Mitotic cell cycle	IMP	24252166
GO:0000398	Process	MRNA splicing, via spliceosome	IBA
GO:0000398	Process	MRNA splicing, via spliceosome	IDA	28781166
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	22190034, 22351768, 22365833, 24996188, 25416956, 28514442, 32296183, 32814053, 33961781, 34694367, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	28781166
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	24252166
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IMP	22351768
GO:0008380	Process	RNA splicing	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0034501	Process	Protein localization to kinetochore	IMP	22351768
GO:0042802	Function	Identical protein binding	IPI	22365833
GO:0071005	Component	U2-type precatalytic spliceosome	IDA	28781166
GO:0097431	Component	Mitotic spindle pole	IDA	22351768

Other IDs

• MIM: 600549
• HGNC: 5958
• e!Ensembl: ENSG00000113141

Protein

• UniProt ID: Q13123
• Protein name: Protein Red (Cytokine IK) (IK factor) (Protein RER)
• Protein function: Involved in pre-mRNA splicing as a component of the spliceosome (PubMed:28781166). Auxiliary spliceosomal protein that regulates selection of alternative splice sites in a small set of target pre-mRNA species (Probable). Required for normal mito
• PDB: 5O9Z, 6Q8I, 8QO9, 8QZS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07808	RED_N	76 → 302	RED-like protein N-terminal region	Family
  PF07807	RED_C	445 → 554	RED-like protein C-terminal region	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10216252}.
• Sequence:

  MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEM
  PREYNEDEDPAARRRKKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELI
  STTANYRAVGPTAEADKSAAEKRRQLIQESKFLGGDMEHTHLVKGLDFALLQKVRAEIAS
  KEKEEEELMEKPQKETKKDEDPENKIEFKTRLGRNVYRMLFKSKAYERNELFLPGRMAYV
  VDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVISKLTQILSYLRQGTRNKKLKK
  KDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRERDRDRDRERER
  ERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGSTKELIKSINEKFAGSAGW
  EGTESLKKPEDKKQLGDFFGMSNSYAECYPATMDDMAVDSDEEVDYSKMDQGNKKGPLGR
  WDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIE
  KRKKMEADGVEVKRPKY

• Sequence length: 557