Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3550
Gene name Gene Name - the full gene name approved by the HGNC.	IK cytokine
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IK
Synonyms (NCBI Gene) Gene synonyms aliases	CSA2, RED, RER
Chromosome Chromosome number	5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	5q31.3
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene was identified by its RED repeat, a stretch of repeated arginine, glutamic acid and aspartic acid residues. The protein localizes to discrete dots within the nucleus, excluding the nucleolus. Its function is unknown. This

Show/Hide all(5)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025539	hsa-miR-34a-5p	Proteomics	21566225
MIRT048953	hsa-miR-92a-3p	CLASH	23622248
MIRT040554	hsa-miR-92b-3p	CLASH	23622248
MIRT2247169	hsa-miR-3674	CLIP-seq
MIRT2247170	hsa-miR-3978	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000228	Component	Nuclear chromosome	IMP	24252166
GO:0000278	Process	Mitotic cell cycle	IMP	24252166
GO:0000398	Process	MRNA splicing, via spliceosome	IBA
GO:0000398	Process	MRNA splicing, via spliceosome	IDA	28781166
GO:0000922	Component	Spindle pole	IEA
GO:0005515	Function	Protein binding	IPI	22190034, 22351768, 22365833, 24996188, 25416956, 28514442, 32296183, 32814053, 33961781, 34694367, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	28781166
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	24252166
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0007094	Process	Mitotic spindle assembly checkpoint signaling	IMP	22351768
GO:0008380	Process	RNA splicing	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0034501	Process	Protein localization to kinetochore	IMP	22351768
GO:0042802	Function	Identical protein binding	IPI	22365833
GO:0071005	Component	U2-type precatalytic spliceosome	IDA	28781166
GO:0097431	Component	Mitotic spindle pole	IDA	22351768

MIM	HGNC	e!Ensembl
600549	5958	ENSG00000113141

Protein

UniProt ID

Q13123

Protein name

Protein Red (Cytokine IK) (IK factor) (Protein RER)

Protein function

Involved in pre-mRNA splicing as a component of the spliceosome (PubMed:28781166). Auxiliary spliceosomal protein that regulates selection of alternative splice sites in a small set of target pre-mRNA species (Probable). Required for normal mito

PDB

5O9Z , 6Q8I , 8QO9 , 8QZS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07808	RED_N	76 → 302	RED-like protein N-terminal region	Family
PF07807	RED_C	445 → 554	RED-like protein C-terminal region	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:10216252}.

Sequence

MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEM
PREYNEDEDPAARRRKKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELI
STTANYRAVGPTAEADKSAAEKRRQLIQESKFLGGDMEHTHLVKGLDFALLQKVRAEIAS
KEKEEEELMEKPQKETKKDEDPENKIEFKTRLGRNVYRMLFKSKAYERNELFLPGRMAYV
VDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVISKLTQILSYLRQGTRNKKLKK
KDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRERDRDRDRERER
ERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGSTKELIKSINEKFAGSAGW
EGTESLKKPEDKKQLGDFFGMSNSYAECYPATMDDMAVDSDEEVDYSKMDQGNKKGPLGR
WDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIE
KRKKMEADGVEVKRPKY

Sequence length

557

Interactions

View interactions

IK (IK cytokine)