ANKRD37 (ankyrin repeat domain 37)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 353322
Gene name Ankyrin repeat domain 37
Gene symbol ANKRD37
Synonyms (NCBI Gene)
Lrp2bp
Chromosome 4
Chromosome location 4q35.1
miRNA miRNA information provided by mirtarbase database.
8
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
miRTarBase ID miRNA Experiments Reference
MIRT783728 hsa-miR-330-3p CLIP-seq
MIRT783729 hsa-miR-4422 CLIP-seq
MIRT783730 hsa-miR-4731-3p CLIP-seq
MIRT783731 hsa-miR-4801 CLIP-seq
MIRT2171789 hsa-miR-1273d CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0001673 Component Male germ cell nucleus IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619021 29593 ENSG00000186352
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q7Z713
Protein name Ankyrin repeat domain-containing protein 37 (Low-density lipoprotein receptor-related protein 2-binding protein) (hLrp2bp)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13637 Ank_4 64 → 117 Repeat
Tissue specificity TISSUE SPECIFICITY: Mainly expressed in testis, small intestine, colon, blood leukocytes and in pancreatic adenocarcinoma cells. {ECO:0000269|PubMed:15809689}.
Sequence 
MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQ
DVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIK
CMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
Sequence length 158
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (2)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CONGENITAL DYSPLASIA OF THE HIP — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (2)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Anemia Iron Deficiency Associate 29110513
★★★★★
★☆☆☆☆
Found in Text Mining only
Scleroderma Systemic Associate 33069728
★★★★★
★☆☆☆☆
Found in Text Mining only