Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	3516
Gene name	Recombination signal binding protein for immunoglobulin kappa J region
Gene symbol	RBPJ
Synonyms (NCBI Gene)	AOS3CBF-1CBF1IGKJRBIGKJRB1KBF2RBP-JRBP-J kappaRBP-JKRBPJKRBPSUHSUHcsl
Chromosome	4
Chromosome location	4p15.2
Summary	The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by

Show/Hide all (7)

SNP ID	Visualize variation	Clinical significance	Consequence
rs387907270	A>G	Pathogenic	Coding sequence variant, missense variant
rs387907271	A>G	Pathogenic	Coding sequence variant, missense variant
rs1064794801	CTACTGCAGTGGA>-	Likely-pathogenic	Coding sequence variant, splice acceptor variant, intron variant
rs1553878198	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1553878211	A>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1553880029	T>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1553882550	C>A	Likely-pathogenic	Coding sequence variant, missense variant

208

Show/Hide all (208)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019785	hsa-miR-375	Microarray	20215506
MIRT020670	hsa-miR-155-5p	Proteomics	18668040
MIRT022527	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT052218	hsa-let-7b-5p	CLASH	23622248
MIRT050652	hsa-miR-18a-5p	CLASH	23622248
MIRT212604	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT212605	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT212610	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT212611	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT212612	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT212619	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT212608	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT492458	hsa-miR-3133	PAR-CLIP	20371350
MIRT492457	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT212615	hsa-miR-3609	PAR-CLIP	20371350
MIRT212617	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT212606	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT492455	hsa-miR-3923	PAR-CLIP	20371350
MIRT212613	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT309949	hsa-miR-4468	PAR-CLIP	20371350
MIRT492452	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT492451	hsa-miR-8061	PAR-CLIP	20371350
MIRT356391	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT566105	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT566104	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT356400	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT566103	hsa-miR-6814-5p	PAR-CLIP	20371350
MIRT356396	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT356390	hsa-miR-193b-5p	PAR-CLIP	20371350
MIRT356398	hsa-miR-5585-3p	PAR-CLIP	20371350
MIRT566102	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT356409	hsa-miR-548ac	PAR-CLIP	20371350
MIRT356416	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT356403	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT356404	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT356407	hsa-miR-548z	PAR-CLIP	20371350
MIRT356402	hsa-miR-490-3p	PAR-CLIP	20371350
MIRT356392	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT561670	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT309928	hsa-miR-6077	PAR-CLIP	20371350
MIRT212604	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT212605	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT212610	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT212611	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT212612	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT212619	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT212608	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT492458	hsa-miR-3133	PAR-CLIP	22012620
MIRT492457	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT212615	hsa-miR-3609	PAR-CLIP	22012620
MIRT212617	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT492456	hsa-miR-302f	PAR-CLIP	22012620
MIRT212606	hsa-miR-32-3p	PAR-CLIP	22012620
MIRT492455	hsa-miR-3923	PAR-CLIP	22012620
MIRT492454	hsa-miR-532-5p	PAR-CLIP	22012620
MIRT212613	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT212618	hsa-miR-3064-3p	PAR-CLIP	22012620
MIRT492453	hsa-miR-4715-3p	PAR-CLIP	22012620
MIRT492452	hsa-miR-4760-5p	PAR-CLIP	22012620
MIRT492451	hsa-miR-8061	PAR-CLIP	22012620
MIRT212604	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT212605	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT212610	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT212611	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT212612	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT212619	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT212608	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT492458	hsa-miR-3133	PAR-CLIP	23446348
MIRT492457	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT212615	hsa-miR-3609	PAR-CLIP	23446348
MIRT212617	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT212606	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT492455	hsa-miR-3923	PAR-CLIP	23446348
MIRT212613	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT309949	hsa-miR-4468	PAR-CLIP	23446348
MIRT212618	hsa-miR-3064-3p	PAR-CLIP	23446348
MIRT492452	hsa-miR-4760-5p	PAR-CLIP	23446348
MIRT492451	hsa-miR-8061	PAR-CLIP	23446348
MIRT212604	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT212605	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT212610	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT212611	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT212612	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT212619	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT212608	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT492458	hsa-miR-3133	PAR-CLIP	23592263
MIRT492457	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT212615	hsa-miR-3609	PAR-CLIP	23592263
MIRT212617	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT492456	hsa-miR-302f	PAR-CLIP	23592263
MIRT212606	hsa-miR-32-3p	PAR-CLIP	23592263
MIRT492455	hsa-miR-3923	PAR-CLIP	23592263
MIRT492454	hsa-miR-532-5p	PAR-CLIP	23592263
MIRT212613	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT309949	hsa-miR-4468	PAR-CLIP	23592263
MIRT212618	hsa-miR-3064-3p	PAR-CLIP	23592263
MIRT492453	hsa-miR-4715-3p	PAR-CLIP	23592263
MIRT492452	hsa-miR-4760-5p	PAR-CLIP	23592263
MIRT492451	hsa-miR-8061	PAR-CLIP	23592263
MIRT439796	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439796	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT734185	hsa-miR-590-5p	Luciferase reporter assayqRT-PCRWestern blotting	33389283
MIRT212604	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT212605	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT212610	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT212611	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT212612	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT212619	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT212608	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT492458	hsa-miR-3133	PAR-CLIP	20371350
MIRT492457	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT212615	hsa-miR-3609	PAR-CLIP	20371350
MIRT212617	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT212606	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT492455	hsa-miR-3923	PAR-CLIP	20371350
MIRT212613	hsa-miR-545-3p	PAR-CLIP	20371350
MIRT309949	hsa-miR-4468	PAR-CLIP	20371350
MIRT492452	hsa-miR-4760-5p	PAR-CLIP	20371350
MIRT492451	hsa-miR-8061	PAR-CLIP	20371350
MIRT356391	hsa-miR-561-3p	PAR-CLIP	20371350
MIRT566105	hsa-miR-3622a-3p	PAR-CLIP	20371350
MIRT566104	hsa-miR-3622b-3p	PAR-CLIP	20371350
MIRT356400	hsa-miR-6765-3p	PAR-CLIP	20371350
MIRT566103	hsa-miR-6814-5p	PAR-CLIP	20371350
MIRT356396	hsa-miR-4774-5p	PAR-CLIP	20371350
MIRT356390	hsa-miR-193b-5p	PAR-CLIP	20371350
MIRT356398	hsa-miR-5585-3p	PAR-CLIP	20371350
MIRT566102	hsa-miR-4446-5p	PAR-CLIP	20371350
MIRT356409	hsa-miR-548ac	PAR-CLIP	20371350
MIRT356416	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT356403	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT356404	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT356407	hsa-miR-548z	PAR-CLIP	20371350
MIRT356402	hsa-miR-490-3p	PAR-CLIP	20371350
MIRT356392	hsa-miR-619-3p	PAR-CLIP	20371350
MIRT561670	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT309928	hsa-miR-6077	PAR-CLIP	20371350
MIRT212604	hsa-miR-15a-5p	PAR-CLIP	22012620
MIRT212605	hsa-miR-16-5p	PAR-CLIP	22012620
MIRT212610	hsa-miR-195-5p	PAR-CLIP	22012620
MIRT212611	hsa-miR-424-5p	PAR-CLIP	22012620
MIRT212612	hsa-miR-497-5p	PAR-CLIP	22012620
MIRT212619	hsa-miR-6838-5p	PAR-CLIP	22012620
MIRT212608	hsa-miR-15b-5p	PAR-CLIP	22012620
MIRT492458	hsa-miR-3133	PAR-CLIP	22012620
MIRT492457	hsa-miR-186-5p	PAR-CLIP	22012620
MIRT212615	hsa-miR-3609	PAR-CLIP	22012620
MIRT212617	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT492456	hsa-miR-302f	PAR-CLIP	22012620
MIRT212606	hsa-miR-32-3p	PAR-CLIP	22012620
MIRT492455	hsa-miR-3923	PAR-CLIP	22012620
MIRT492454	hsa-miR-532-5p	PAR-CLIP	22012620
MIRT212613	hsa-miR-545-3p	PAR-CLIP	22012620
MIRT212618	hsa-miR-3064-3p	PAR-CLIP	22012620
MIRT492453	hsa-miR-4715-3p	PAR-CLIP	22012620
MIRT492452	hsa-miR-4760-5p	PAR-CLIP	22012620
MIRT492451	hsa-miR-8061	PAR-CLIP	22012620
MIRT212604	hsa-miR-15a-5p	PAR-CLIP	23446348
MIRT212605	hsa-miR-16-5p	PAR-CLIP	23446348
MIRT212610	hsa-miR-195-5p	PAR-CLIP	23446348
MIRT212611	hsa-miR-424-5p	PAR-CLIP	23446348
MIRT212612	hsa-miR-497-5p	PAR-CLIP	23446348
MIRT212619	hsa-miR-6838-5p	PAR-CLIP	23446348
MIRT212608	hsa-miR-15b-5p	PAR-CLIP	23446348
MIRT492458	hsa-miR-3133	PAR-CLIP	23446348
MIRT492457	hsa-miR-186-5p	PAR-CLIP	23446348
MIRT212615	hsa-miR-3609	PAR-CLIP	23446348
MIRT212617	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT212606	hsa-miR-32-3p	PAR-CLIP	23446348
MIRT492455	hsa-miR-3923	PAR-CLIP	23446348
MIRT212613	hsa-miR-545-3p	PAR-CLIP	23446348
MIRT309949	hsa-miR-4468	PAR-CLIP	23446348
MIRT212618	hsa-miR-3064-3p	PAR-CLIP	23446348
MIRT492452	hsa-miR-4760-5p	PAR-CLIP	23446348
MIRT492451	hsa-miR-8061	PAR-CLIP	23446348
MIRT212604	hsa-miR-15a-5p	PAR-CLIP	23592263
MIRT212605	hsa-miR-16-5p	PAR-CLIP	23592263
MIRT212610	hsa-miR-195-5p	PAR-CLIP	23592263
MIRT212611	hsa-miR-424-5p	PAR-CLIP	23592263
MIRT212612	hsa-miR-497-5p	PAR-CLIP	23592263
MIRT212619	hsa-miR-6838-5p	PAR-CLIP	23592263
MIRT212608	hsa-miR-15b-5p	PAR-CLIP	23592263
MIRT492458	hsa-miR-3133	PAR-CLIP	23592263
MIRT492457	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT212615	hsa-miR-3609	PAR-CLIP	23592263
MIRT212617	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT492456	hsa-miR-302f	PAR-CLIP	23592263
MIRT212606	hsa-miR-32-3p	PAR-CLIP	23592263
MIRT492455	hsa-miR-3923	PAR-CLIP	23592263
MIRT492454	hsa-miR-532-5p	PAR-CLIP	23592263
MIRT212613	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT309949	hsa-miR-4468	PAR-CLIP	23592263
MIRT212618	hsa-miR-3064-3p	PAR-CLIP	23592263
MIRT492453	hsa-miR-4715-3p	PAR-CLIP	23592263
MIRT492452	hsa-miR-4760-5p	PAR-CLIP	23592263
MIRT492451	hsa-miR-8061	PAR-CLIP	23592263
MIRT1553015	hsa-miR-1193	CLIP-seq
MIRT1553016	hsa-miR-2392	CLIP-seq
MIRT1553017	hsa-miR-3140-5p	CLIP-seq
MIRT1553018	hsa-miR-3155	CLIP-seq
MIRT1553019	hsa-miR-3155b	CLIP-seq
MIRT1553020	hsa-miR-484	CLIP-seq
MIRT2088394	hsa-miR-3682-5p	CLIP-seq
MIRT2088395	hsa-miR-4699-3p	CLIP-seq
MIRT2393570	hsa-miR-1909	CLIP-seq
MIRT2393571	hsa-miR-3065-3p	CLIP-seq
MIRT2393572	hsa-miR-4270	CLIP-seq
MIRT2393573	hsa-miR-4441	CLIP-seq

135

Show/Hide all (135)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	18663143
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	16691198
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	18663143
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001525	Process	Angiogenesis	ISS
GO:0001756	Process	Somitogenesis	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0001974	Process	Blood vessel remodeling	ISS
GO:0002193	Component	MAML1-RBP-Jkappa- ICN1 complex	IBA
GO:0002193	Component	MAML1-RBP-Jkappa- ICN1 complex	IDA	16510869
GO:0002437	Process	Inflammatory response to antigenic stimulus	IEA
GO:0003139	Process	Secondary heart field specification	IEA
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003151	Process	Outflow tract morphogenesis	ISS
GO:0003157	Process	Endocardium development	IEA
GO:0003160	Process	Endocardium morphogenesis	IEA
GO:0003160	Process	Endocardium morphogenesis	ISS
GO:0003176	Process	Aortic valve development	IEA
GO:0003176	Process	Aortic valve development	ISS
GO:0003177	Process	Pulmonary valve development	IEA
GO:0003177	Process	Pulmonary valve development	ISS
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	IEA
GO:0003198	Process	Epithelial to mesenchymal transition involved in endocardial cushion formation	ISS
GO:0003214	Process	Cardiac left ventricle morphogenesis	IEA
GO:0003214	Process	Cardiac left ventricle morphogenesis	ISS
GO:0003222	Process	Ventricular trabecula myocardium morphogenesis	IEA
GO:0003222	Process	Ventricular trabecula myocardium morphogenesis	ISS
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	9874765
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	9874765
GO:0005515	Function	Protein binding	IPI	8627785, 9874765, 10713164, 16510869, 16530044, 17284587, 19907488, 21102556, 21475249, 22325781, 22810586, 23022380, 25609649, 26302407, 26496610, 29030483, 33961781
GO:0005634	Component	Nucleus	IDA	9874765, 21102556
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005730	Component	Nucleolus	IDA	9874765
GO:0005737	Component	Cytoplasm	IDA	21102556
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006959	Process	Humoral immune response	IEA
GO:0007219	Process	Notch signaling pathway	IBA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007219	Process	Notch signaling pathway	IMP	18663143, 21311046
GO:0007221	Process	Positive regulation of transcription of Notch receptor target	IDA	21102556
GO:0007221	Process	Positive regulation of transcription of Notch receptor target	IEA
GO:0007221	Process	Positive regulation of transcription of Notch receptor target	IEA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	IMP	21311046
GO:0008283	Process	Cell population proliferation	IEA
GO:0009912	Process	Auditory receptor cell fate commitment	IEA
GO:0009957	Process	Epidermal cell fate specification	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0017053	Component	Transcription repressor complex	IDA	16691198
GO:0021983	Process	Pituitary gland development	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0030279	Process	Negative regulation of ossification	IEA
GO:0030279	Process	Negative regulation of ossification	ISS
GO:0030513	Process	Positive regulation of BMP signaling pathway	IEA
GO:0030513	Process	Positive regulation of BMP signaling pathway	ISS
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035912	Process	Dorsal aorta morphogenesis	IEA
GO:0035912	Process	Dorsal aorta morphogenesis	ISS
GO:0036302	Process	Atrioventricular canal development	IEA
GO:0036302	Process	Atrioventricular canal development	ISS
GO:0042742	Process	Defense response to bacterium	IEA
GO:0043011	Process	Myeloid dendritic cell differentiation	IEA
GO:0043467	Process	Regulation of generation of precursor metabolites and energy	IDA	23303788
GO:0043565	Function	Sequence-specific DNA binding	IDA	23303788
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045165	Process	Cell fate commitment	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	10713164
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	23303788
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18663143, 20890042
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0048505	Process	Regulation of timing of cell differentiation	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048733	Process	Sebaceous gland development	IEA
GO:0048820	Process	Hair follicle maturation	IEA
GO:0048844	Process	Artery morphogenesis	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	ISS
GO:0060379	Process	Cardiac muscle cell myoblast differentiation	IEA
GO:0060379	Process	Cardiac muscle cell myoblast differentiation	ISS
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060486	Process	Club cell differentiation	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	ISS
GO:0060844	Process	Arterial endothelial cell fate commitment	IEA
GO:0061344	Process	Regulation of cell adhesion involved in heart morphogenesis	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	16287852
GO:0072089	Process	Stem cell proliferation	IEA
GO:0072554	Process	Blood vessel lumenization	IEA
GO:0072554	Process	Blood vessel lumenization	ISS
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0097101	Process	Blood vessel endothelial cell fate specification	IEA
GO:0097101	Process	Blood vessel endothelial cell fate specification	ISS
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	25038826
GO:0140297	Function	DNA-binding transcription factor binding	IDA	23303788
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16691198
GO:1901186	Process	Positive regulation of ERBB signaling pathway	IEA
GO:1901186	Process	Positive regulation of ERBB signaling pathway	ISS
GO:1901189	Process	Positive regulation of ephrin receptor signaling pathway	IEA
GO:1901189	Process	Positive regulation of ephrin receptor signaling pathway	ISS
GO:2000138	Process	Positive regulation of cell proliferation involved in heart morphogenesis	IEA
GO:2000138	Process	Positive regulation of cell proliferation involved in heart morphogenesis	ISS
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
147183	5724	ENSG00000168214

Q06330

Protein name

Recombining binding protein suppressor of hairless (CBF-1) (J kappa-recombination signal-binding protein) (RBP-J kappa) (RBP-J) (RBP-JK) (Renal carcinoma antigen NY-REN-30)

Protein function

Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not assoc

PDB

2F8X , 3NBN , 3V79 , 6PY8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09271	LAG1-DNAbind	48 → 178	LAG1, DNA binding	Domain
PF09270	BTD	206 → 328	Beta-trefoil DNA-binding domain	Domain

Sequence

MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS

Sequence length

500

Interactions

View interactions

	KEGG		Reactome
	Notch signaling pathway Th1 and Th2 cell differentiation Spinocerebellar ataxia Human papillomavirus infection Epstein-Barr virus infection Viral carcinogenesis		Pre-NOTCH Transcription and Translation NOTCH1 Intracellular Domain Regulates Transcription NOTCH2 intracellular domain regulates transcription Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Notch-HLH transcription pathway RUNX3 regulates NOTCH signaling NOTCH3 Intracellular Domain Regulates Transcription NOTCH4 Intracellular Domain Regulates Transcription

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Adams-Oliver syndrome 3	Likely pathogenic; Pathogenic	rs2475204247, rs387907270, rs387907271, rs1553878211, rs1553880029, rs1553882550	RCV002467425 RCV000030707 RCV000030708 RCV000662238 RCV000662239 RCV000662240
Type 2 diabetes mellitus	Likely pathogenic	rs1553878211	RCV000987431

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Malignant tumor of esophagus	Benign	rs2788856	RCV005922223
RBPJ-related disorder	Uncertain significance; Benign; Likely benign	rs2475203966, rs529513495, rs2475374172, rs2475358985, rs769300879, rs1382137277, rs573271840, rs762929152, rs150367056, rs143956090	RCV004731273 RCV004754884 RCV003408311 RCV003408589 RCV003901566 RCV003911452 RCV003971838 RCV003966812 RCV003936052 RCV003913016
Sarcoma	Benign	rs2788856	RCV005922224
Uterine corpus endometrial carcinoma	Benign	rs2788856	RCV005922225

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adams Oliver syndrome	Associate	22883147, 26299364, 29924900
Arthritis Rheumatoid	Associate	25014791, 26604133, 33517445
Arthritis Rheumatoid	Inhibit	39350019
Bone Resorption	Associate	39350019
Breast Neoplasms	Associate	23181716, 35844785
Burkitt Lymphoma	Associate	32054837
Carcinoma Hepatocellular	Associate	36147467, 36717584, 36938729
Carcinoma Renal Cell	Associate	35368029
Carcinoma Squamous Cell	Inhibit	30653445
Carcinoma Squamous Cell	Associate	31467287
Cerebral Infarction	Associate	30075508
Cerebral Small Vessel Diseases	Associate	30075508
Endometrial Neoplasms	Associate	36575819
Genetic Diseases Inborn	Associate	22883147
Glioblastoma	Associate	28571041, 32885530
Glioma	Associate	28571041, 33795525
Hypoxia	Associate	24696491
Hypoxia Brain	Stimulate	28571041
Hypoxia Brain	Associate	40710331
IgA Vasculitis	Associate	9502421
Infections	Associate	21507979, 22253595, 25540367
Inflammation	Associate	26604133
Kidney Neoplasms	Associate	35368029
Laryngeal Neoplasms	Associate	29971915
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	36184659
Lung Neoplasms	Associate	25589461
Lymphoma B Cell	Associate	25540367
Lymphoma Non Hodgkin	Stimulate	33795525
Microsatellite Instability	Associate	15919901
Myopathies Structural Congenital	Associate	35263597
Neoplasms	Associate	23181716, 26877261, 28377481, 28571041, 30653445, 31467287, 32885530, 34663810, 36575819
Ovarian Neoplasms	Associate	36366750
Papillomavirus Infections	Associate	16378632
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	24952875, 9111040
Prostatic Neoplasms	Associate	26202358
Sarcoma Kaposi	Associate	19906914, 24696491
Schizophrenia	Associate	29593239
Stomach Neoplasms	Associate	14570916, 27489358
Syndrome	Associate	22883147
Tongue Neoplasms	Associate	31023264
Triple Negative Breast Neoplasms	Associate	28377481
Urinary Bladder Neoplasms	Associate	35701858
Uterine Cervical Neoplasms	Associate	39206965
Wolf Hirschhorn Syndrome	Stimulate	36980907

RBPJ (recombination signal binding protein for immunoglobulin kappa J region)