Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3516
Gene name Gene Name - the full gene name approved by the HGNC.
Recombination signal binding protein for immunoglobulin kappa J region
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
RBPJ
Synonyms (NCBI Gene) Gene synonyms aliases
AOS3, CBF-1, CBF1, IGKJRB, IGKJRB1, KBF2, RBP-J, RBP-J kappa, RBP-JK, RBPJK, RBPSUH, SUH, csl
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4p15.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a transcriptional regulator important in the Notch signaling pathway. The encoded protein acts as a repressor when not bound to Notch proteins and an activator when bound to Notch proteins. It is thought to function by
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs387907270 A>G Pathogenic Coding sequence variant, missense variant
rs387907271 A>G Pathogenic Coding sequence variant, missense variant
rs1064794801 CTACTGCAGTGGA>- Likely-pathogenic Coding sequence variant, splice acceptor variant, intron variant
rs1553878198 C>G Likely-pathogenic Coding sequence variant, missense variant
rs1553878211 A>G Likely-pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT019785 hsa-miR-375 Microarray 20215506
MIRT020670 hsa-miR-155-5p Proteomics 18668040
MIRT022527 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT052218 hsa-let-7b-5p CLASH 23622248
MIRT050652 hsa-miR-18a-5p CLASH 23622248
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IMP 18663143
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
147183 5724 ENSG00000168214
Protein
UniProt ID Q06330
Protein name Recombining binding protein suppressor of hairless (CBF-1) (J kappa-recombination signal-binding protein) (RBP-J kappa) (RBP-J) (RBP-JK) (Renal carcinoma antigen NY-REN-30)
Protein function Transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. Acts as a transcriptional repressor when it is not assoc
PDB 2F8X , 3NBN , 3V79 , 6PY8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09271 LAG1-DNAbind 48 178 LAG1, DNA binding Domain
PF09270 BTD 206 328 Beta-trefoil DNA-binding domain Domain
Sequence
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNAD
LC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASW
TIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
Sequence length 500
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Notch signaling pathway
Th1 and Th2 cell differentiation
Spinocerebellar ataxia
Human papillomavirus infection
Epstein-Barr virus infection
Viral carcinogenesis
  Pre-NOTCH Transcription and Translation
NOTCH1 Intracellular Domain Regulates Transcription
NOTCH2 intracellular domain regulates transcription
Constitutive Signaling by NOTCH1 PEST Domain Mutants
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Notch-HLH transcription pathway
RUNX3 regulates NOTCH signaling
NOTCH3 Intracellular Domain Regulates Transcription
NOTCH4 Intracellular Domain Regulates Transcription
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Adams-Oliver Syndrome adams-oliver syndrome 3 rs387907270, rs387907271, rs1553878211, rs1553880029, rs1553882550 N/A
Diabetes Mellitus Type 2 diabetes mellitus rs1553878211 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Crohn Disease Crohn's disease N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adams Oliver syndrome Associate 22883147, 26299364, 29924900
Arthritis Rheumatoid Associate 25014791, 26604133, 33517445
Arthritis Rheumatoid Inhibit 39350019
Bone Resorption Associate 39350019
Breast Neoplasms Associate 23181716, 35844785
Burkitt Lymphoma Associate 32054837
Carcinoma Hepatocellular Associate 36147467, 36717584, 36938729
Carcinoma Renal Cell Associate 35368029
Carcinoma Squamous Cell Inhibit 30653445
Carcinoma Squamous Cell Associate 31467287