Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	351
Gene name Gene Name - the full gene name approved by the HGNC.	Amyloid beta precursor protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	APP
Synonyms (NCBI Gene) Gene synonyms aliases	AAA, ABETA, ABPP, AD1, APPI, CTFgamma, CVAP, PN-II, PN2, alpha-sAPP, preA4
Chromosome Chromosome number	21
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	21q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptio

Show/Hide all(17)

SNP ID	Visualize variation	Clinical significance	Consequence
rs63749810	C>T	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63749964	A>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750064	C>G,T	Not-provided, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750066	C>T	Pathogenic, uncertain-significance, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750264	C>A,G,T	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750363	C>G	Pathogenic, uncertain-significance	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750399	T>A,C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750579	C>G,T	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750643	T>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750671	G>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750734	C>T	Pathogenic, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750921	G>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63750973	G>A	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs63751039	T>C	Pathogenic, not-provided	Genic downstream transcript variant, coding sequence variant, missense variant
rs145081708	A>G	Uncertain-significance, benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs193922916	G>A,C	Pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant
rs201269325	C>A,T	Likely-pathogenic	Genic downstream transcript variant, missense variant, coding sequence variant

Show/Hide all(841)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay	18684319
MIRT001935	hsa-miR-106a-5p	Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay	18684319
MIRT001934	hsa-miR-520c-3p	Western blot	18684319
MIRT001935	hsa-miR-106a-5p	qRT-PCR	18684319
MIRT001934	hsa-miR-520c-3p	qRT-PCR	18684319
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	18684319
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	18684319
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	18684319
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay, Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18684319
MIRT001934	hsa-miR-520c-3p	Luciferase reporter assay, Western blot	18684319
MIRT000430	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	20395292
MIRT000430	hsa-miR-101-3p	qRT-PCR, Luciferase reporter assay, Western blot	20395292
MIRT003382	hsa-miR-20a-5p	GFP reporter assay, qRT-PCR, Western blot	20458444
MIRT003382	hsa-miR-20a-5p	GFP reporter assay, qRT-PCR, Western blot	20458444
MIRT003382	hsa-miR-20a-5p	GFP reporter assay, qRT-PCR, Western blot	20458444
MIRT003382	hsa-miR-20a-5p	Luciferase reporter assay, Western blot	19110058
MIRT003898	hsa-miR-17-5p	Luciferase reporter assay, Western blot	19110058
MIRT000373	hsa-miR-106b-5p	Luciferase reporter assay, Western blot	19110058
MIRT003899	hsa-miR-15a-5p	Luciferase reporter assay	19110058
MIRT003900	hsa-miR-130a-3p	Luciferase reporter assay	19110058
MIRT003901	hsa-let-7d-5p	Luciferase reporter assay	19110058
MIRT003902	hsa-let-7a-5p	Luciferase reporter assay	19110058
MIRT001935	hsa-miR-106a-5p	Luciferase reporter assay	19110058
MIRT000430	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21172309
MIRT000430	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21172309
MIRT000430	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21172309
MIRT000430	hsa-miR-101-3p	Luciferase reporter assay, qRT-PCR, Western blot	21172309
MIRT031838	hsa-miR-16-5p	Proteomics	18668040
MIRT003898	hsa-miR-17-5p	CLASH	23622248
MIRT003898	hsa-miR-17-5p	CLASH	23622248
MIRT048186	hsa-miR-196a-5p	CLASH	23622248
MIRT046755	hsa-miR-222-3p	CLASH	23622248
MIRT046755	hsa-miR-222-3p	CLASH	23622248
MIRT043760	hsa-miR-328-3p	CLASH	23622248
MIRT042631	hsa-miR-423-3p	CLASH	23622248
MIRT042260	hsa-miR-484	CLASH	23622248
MIRT038001	hsa-miR-500a-5p	CLASH	23622248
MIRT037918	hsa-miR-532-3p	CLASH	23622248
MIRT052777	hsa-miR-1260b	CLASH	23622248
MIRT052777	hsa-miR-1260b	CLASH	23622248
MIRT052863	hsa-miR-3620-3p	CLASH	23622248
MIRT723035	hsa-miR-548ad-3p	HITS-CLIP	19536157
MIRT723034	hsa-miR-424-3p	HITS-CLIP	19536157
MIRT723033	hsa-miR-4484	HITS-CLIP	19536157
MIRT723032	hsa-miR-551b-5p	HITS-CLIP	19536157
MIRT723031	hsa-miR-3120-3p	HITS-CLIP	19536157
MIRT407081	hsa-miR-6504-3p	HITS-CLIP	19536157
MIRT710394	hsa-miR-3646	HITS-CLIP	19536157
MIRT710393	hsa-miR-6502-3p	HITS-CLIP	19536157
MIRT710392	hsa-miR-5584-5p	HITS-CLIP	19536157
MIRT549358	hsa-miR-4786-5p	HITS-CLIP	19536157
MIRT710391	hsa-miR-5093	HITS-CLIP	19536157
MIRT710389	hsa-miR-4709-3p	HITS-CLIP	19536157
MIRT705588	hsa-miR-224-3p	HITS-CLIP	23313552
MIRT705587	hsa-miR-522-3p	HITS-CLIP	23313552
MIRT705586	hsa-miR-3908	HITS-CLIP	23313552
MIRT705585	hsa-miR-197-5p	HITS-CLIP	23313552
MIRT705584	hsa-miR-3132	HITS-CLIP	23313552
MIRT705583	hsa-miR-6073	HITS-CLIP	23313552
MIRT705582	hsa-miR-3606-5p	HITS-CLIP	23313552
MIRT705581	hsa-miR-1229-5p	HITS-CLIP	23313552
MIRT660592	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT660591	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT660590	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT660589	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT660588	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT660587	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT660586	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT660585	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT660584	hsa-miR-5696	HITS-CLIP	23824327
MIRT660583	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT660582	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT660580	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660581	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT660579	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT660578	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT660577	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT660592	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT660591	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT660590	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT660589	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT660588	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT660587	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT660586	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT660585	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT660584	hsa-miR-5696	HITS-CLIP	23824327
MIRT660583	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT660582	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT660580	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660581	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT660579	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT660578	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT660577	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT559575	hsa-miR-944	PAR-CLIP	21572407
MIRT559573	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT559574	hsa-miR-567	PAR-CLIP	21572407
MIRT559572	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT559571	hsa-miR-3924	PAR-CLIP	21572407
MIRT559570	hsa-miR-297	PAR-CLIP	21572407
MIRT549363	hsa-miR-4311	PAR-CLIP	21572407
MIRT549362	hsa-miR-1276	PAR-CLIP	21572407
MIRT549361	hsa-miR-583	PAR-CLIP	21572407
MIRT549360	hsa-miR-4495	PAR-CLIP	21572407
MIRT549359	hsa-miR-4698	PAR-CLIP	21572407
MIRT549358	hsa-miR-4786-5p	PAR-CLIP	21572407
MIRT543081	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT000430	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT000430	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT543080	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT031838	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT543079	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT543078	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT543077	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT543076	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT003899	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT543075	hsa-miR-3662	PAR-CLIP	21572407
MIRT543074	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT543073	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT543072	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT543071	hsa-miR-298	PAR-CLIP	21572407
MIRT543070	hsa-miR-455-3p	PAR-CLIP	21572407
MIRT084789	hsa-let-7a-2-3p	PAR-CLIP	21572407
MIRT084793	hsa-let-7g-3p	PAR-CLIP	21572407
MIRT031838	hsa-miR-16-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26440600
MIRT031838	hsa-miR-16-5p	ELISA, Immunoprecipitaion, Luciferase reporter assay, qRT-PCR, Western blot	26440600
MIRT543081	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR	27329039
MIRT543081	hsa-miR-144-3p	Luciferase reporter assay, qRT-PCR	27329039
MIRT732983	hsa-miR-31-5p	Immunohistochemistry (IHC), qRT-PCR	32069773
MIRT723035	hsa-miR-548ad-3p	HITS-CLIP	19536157
MIRT723034	hsa-miR-424-3p	HITS-CLIP	19536157
MIRT723033	hsa-miR-4484	HITS-CLIP	19536157
MIRT723032	hsa-miR-551b-5p	HITS-CLIP	19536157
MIRT723031	hsa-miR-3120-3p	HITS-CLIP	19536157
MIRT407081	hsa-miR-6504-3p	HITS-CLIP	19536157
MIRT710394	hsa-miR-3646	HITS-CLIP	19536157
MIRT710393	hsa-miR-6502-3p	HITS-CLIP	19536157
MIRT710392	hsa-miR-5584-5p	HITS-CLIP	19536157
MIRT549358	hsa-miR-4786-5p	HITS-CLIP	19536157
MIRT710391	hsa-miR-5093	HITS-CLIP	19536157
MIRT710389	hsa-miR-4709-3p	HITS-CLIP	19536157
MIRT705588	hsa-miR-224-3p	HITS-CLIP	23313552
MIRT705587	hsa-miR-522-3p	HITS-CLIP	23313552
MIRT705586	hsa-miR-3908	HITS-CLIP	23313552
MIRT705585	hsa-miR-197-5p	HITS-CLIP	23313552
MIRT705584	hsa-miR-3132	HITS-CLIP	23313552
MIRT705583	hsa-miR-6073	HITS-CLIP	23313552
MIRT705582	hsa-miR-3606-5p	HITS-CLIP	23313552
MIRT705581	hsa-miR-1229-5p	HITS-CLIP	23313552
MIRT660592	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT660591	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT660590	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT660589	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT660588	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT660587	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT660586	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT660585	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT660584	hsa-miR-5696	HITS-CLIP	23824327
MIRT660583	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT660582	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT660580	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660581	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT660579	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT660578	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT660577	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT660592	hsa-miR-548a-3p	HITS-CLIP	23824327
MIRT660591	hsa-miR-548ar-3p	HITS-CLIP	23824327
MIRT660590	hsa-miR-548az-3p	HITS-CLIP	23824327
MIRT660589	hsa-miR-548e-3p	HITS-CLIP	23824327
MIRT660588	hsa-miR-548f-3p	HITS-CLIP	23824327
MIRT660587	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT660586	hsa-miR-302b-5p	HITS-CLIP	23824327
MIRT660585	hsa-miR-302d-5p	HITS-CLIP	23824327
MIRT660584	hsa-miR-5696	HITS-CLIP	23824327
MIRT660583	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT660582	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT660580	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT660581	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT660579	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT660578	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT660577	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT559575	hsa-miR-944	PAR-CLIP	21572407
MIRT559573	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT559574	hsa-miR-567	PAR-CLIP	21572407
MIRT559572	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT559571	hsa-miR-3924	PAR-CLIP	21572407
MIRT559570	hsa-miR-297	PAR-CLIP	21572407
MIRT549363	hsa-miR-4311	PAR-CLIP	21572407
MIRT549362	hsa-miR-1276	PAR-CLIP	21572407
MIRT549361	hsa-miR-583	PAR-CLIP	21572407
MIRT549360	hsa-miR-4495	PAR-CLIP	21572407
MIRT549359	hsa-miR-4698	PAR-CLIP	21572407
MIRT549358	hsa-miR-4786-5p	PAR-CLIP	21572407
MIRT543081	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT000430	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT000430	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT543080	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT031838	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT543079	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT543078	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT543077	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT543076	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT003899	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT543075	hsa-miR-3662	PAR-CLIP	21572407
MIRT543074	hsa-miR-3688-3p	PAR-CLIP	21572407
MIRT543073	hsa-miR-545-5p	PAR-CLIP	21572407
MIRT543072	hsa-miR-490-5p	PAR-CLIP	21572407
MIRT543071	hsa-miR-298	PAR-CLIP	21572407
MIRT543070	hsa-miR-455-3p	PAR-CLIP	21572407
MIRT084789	hsa-let-7a-2-3p	PAR-CLIP	21572407
MIRT084793	hsa-let-7g-3p	PAR-CLIP	21572407
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790683	hsa-miR-106a	CLIP-seq
MIRT790684	hsa-miR-106b	CLIP-seq
MIRT790685	hsa-miR-1260	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790687	hsa-miR-1270	CLIP-seq
MIRT790688	hsa-miR-1273d	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790695	hsa-miR-17	CLIP-seq
MIRT790696	hsa-miR-188-3p	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790698	hsa-miR-2052	CLIP-seq
MIRT790699	hsa-miR-20a	CLIP-seq
MIRT790700	hsa-miR-20b	CLIP-seq
MIRT790701	hsa-miR-216b	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790708	hsa-miR-302a	CLIP-seq
MIRT790709	hsa-miR-302b	CLIP-seq
MIRT790710	hsa-miR-302c	CLIP-seq
MIRT790711	hsa-miR-302d	CLIP-seq
MIRT790712	hsa-miR-302e	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT790714	hsa-miR-31	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT790716	hsa-miR-3156-3p	CLIP-seq
MIRT790717	hsa-miR-3158-5p	CLIP-seq
MIRT790718	hsa-miR-323-3p	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT790721	hsa-miR-3606	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT790724	hsa-miR-3663-3p	CLIP-seq
MIRT790725	hsa-miR-3686	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790732	hsa-miR-372	CLIP-seq
MIRT790733	hsa-miR-373	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790737	hsa-miR-3976	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790740	hsa-miR-4286	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790743	hsa-miR-4423-3p	CLIP-seq
MIRT790744	hsa-miR-4434	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790748	hsa-miR-4509	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790750	hsa-miR-4516	CLIP-seq
MIRT790751	hsa-miR-4530	CLIP-seq
MIRT790752	hsa-miR-4531	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT790754	hsa-miR-4539	CLIP-seq
MIRT790755	hsa-miR-4659a-3p	CLIP-seq
MIRT790756	hsa-miR-4659b-3p	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT790758	hsa-miR-4680-5p	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790760	hsa-miR-4694-3p	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790765	hsa-miR-4744	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790768	hsa-miR-4766-5p	CLIP-seq
MIRT790769	hsa-miR-4775	CLIP-seq
MIRT790770	hsa-miR-4778-5p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT790775	hsa-miR-519d	CLIP-seq
MIRT790776	hsa-miR-520a-3p	CLIP-seq
MIRT790777	hsa-miR-520b	CLIP-seq
MIRT790778	hsa-miR-520d-3p	CLIP-seq
MIRT790779	hsa-miR-520e	CLIP-seq
MIRT790780	hsa-miR-520f	CLIP-seq
MIRT790781	hsa-miR-522	CLIP-seq
MIRT790782	hsa-miR-548ad	CLIP-seq
MIRT790783	hsa-miR-548c-3p	CLIP-seq
MIRT790784	hsa-miR-548n	CLIP-seq
MIRT790785	hsa-miR-548t	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790787	hsa-miR-620	CLIP-seq
MIRT790788	hsa-miR-634	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790790	hsa-miR-646	CLIP-seq
MIRT790791	hsa-miR-660	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790793	hsa-miR-664	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT790795	hsa-miR-922	CLIP-seq
MIRT790796	hsa-miR-93	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790683	hsa-miR-106a	CLIP-seq
MIRT790684	hsa-miR-106b	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790687	hsa-miR-1270	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790695	hsa-miR-17	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790797	hsa-miR-205	CLIP-seq
MIRT790698	hsa-miR-2052	CLIP-seq
MIRT790798	hsa-miR-2054	CLIP-seq
MIRT790699	hsa-miR-20a	CLIP-seq
MIRT790700	hsa-miR-20b	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790708	hsa-miR-302a	CLIP-seq
MIRT790709	hsa-miR-302b	CLIP-seq
MIRT790710	hsa-miR-302c	CLIP-seq
MIRT790711	hsa-miR-302d	CLIP-seq
MIRT790712	hsa-miR-302e	CLIP-seq
MIRT790799	hsa-miR-3137	CLIP-seq
MIRT790800	hsa-miR-3152-3p	CLIP-seq
MIRT790717	hsa-miR-3158-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT790725	hsa-miR-3686	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790732	hsa-miR-372	CLIP-seq
MIRT790733	hsa-miR-373	CLIP-seq
MIRT790801	hsa-miR-374c	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790803	hsa-miR-4257	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790804	hsa-miR-4280	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790744	hsa-miR-4434	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790750	hsa-miR-4516	CLIP-seq
MIRT790752	hsa-miR-4531	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790769	hsa-miR-4775	CLIP-seq
MIRT790770	hsa-miR-4778-5p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT790805	hsa-miR-485-5p	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT790775	hsa-miR-519d	CLIP-seq
MIRT790776	hsa-miR-520a-3p	CLIP-seq
MIRT790777	hsa-miR-520b	CLIP-seq
MIRT790778	hsa-miR-520d-3p	CLIP-seq
MIRT790779	hsa-miR-520e	CLIP-seq
MIRT790780	hsa-miR-520f	CLIP-seq
MIRT790784	hsa-miR-548n	CLIP-seq
MIRT790785	hsa-miR-548t	CLIP-seq
MIRT790806	hsa-miR-581	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790787	hsa-miR-620	CLIP-seq
MIRT790807	hsa-miR-626	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790808	hsa-miR-654-3p	CLIP-seq
MIRT790809	hsa-miR-655	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT790796	hsa-miR-93	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790721	hsa-miR-3606	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790803	hsa-miR-4257	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790805	hsa-miR-485-5p	CLIP-seq
MIRT790807	hsa-miR-626	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT2173405	hsa-miR-1245	CLIP-seq
MIRT790685	hsa-miR-1260	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790687	hsa-miR-1270	CLIP-seq
MIRT790688	hsa-miR-1273d	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790696	hsa-miR-188-3p	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790797	hsa-miR-205	CLIP-seq
MIRT790698	hsa-miR-2052	CLIP-seq
MIRT790701	hsa-miR-216b	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT790714	hsa-miR-31	CLIP-seq
MIRT2173406	hsa-miR-3117-3p	CLIP-seq
MIRT2173407	hsa-miR-3123	CLIP-seq
MIRT790799	hsa-miR-3137	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT790800	hsa-miR-3152-3p	CLIP-seq
MIRT790716	hsa-miR-3156-3p	CLIP-seq
MIRT790717	hsa-miR-3158-5p	CLIP-seq
MIRT2173408	hsa-miR-3169	CLIP-seq
MIRT790718	hsa-miR-323-3p	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT2173409	hsa-miR-3616-5p	CLIP-seq
MIRT2173410	hsa-miR-3622a-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT2173411	hsa-miR-3647-5p	CLIP-seq
MIRT790724	hsa-miR-3663-3p	CLIP-seq
MIRT790725	hsa-miR-3686	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790801	hsa-miR-374c	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT2173412	hsa-miR-383	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790737	hsa-miR-3976	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790804	hsa-miR-4280	CLIP-seq
MIRT790740	hsa-miR-4286	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790743	hsa-miR-4423-3p	CLIP-seq
MIRT790744	hsa-miR-4434	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790748	hsa-miR-4509	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790750	hsa-miR-4516	CLIP-seq
MIRT790751	hsa-miR-4530	CLIP-seq
MIRT790752	hsa-miR-4531	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT790754	hsa-miR-4539	CLIP-seq
MIRT2173413	hsa-miR-4635	CLIP-seq
MIRT790755	hsa-miR-4659a-3p	CLIP-seq
MIRT790756	hsa-miR-4659b-3p	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT790758	hsa-miR-4680-5p	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790765	hsa-miR-4744	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT2173414	hsa-miR-4759	CLIP-seq
MIRT2173415	hsa-miR-4772-5p	CLIP-seq
MIRT790769	hsa-miR-4775	CLIP-seq
MIRT790770	hsa-miR-4778-5p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT2173416	hsa-miR-495	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT2173417	hsa-miR-548a-5p	CLIP-seq
MIRT2173418	hsa-miR-548ab	CLIP-seq
MIRT790782	hsa-miR-548ad	CLIP-seq
MIRT2173419	hsa-miR-548ak	CLIP-seq
MIRT2173420	hsa-miR-548b-5p	CLIP-seq
MIRT790783	hsa-miR-548c-3p	CLIP-seq
MIRT2173421	hsa-miR-548c-5p	CLIP-seq
MIRT2173422	hsa-miR-548d-5p	CLIP-seq
MIRT2173423	hsa-miR-548h	CLIP-seq
MIRT2173424	hsa-miR-548i	CLIP-seq
MIRT2173425	hsa-miR-548j	CLIP-seq
MIRT2173426	hsa-miR-548k	CLIP-seq
MIRT2173427	hsa-miR-548l	CLIP-seq
MIRT2173428	hsa-miR-548w	CLIP-seq
MIRT2173429	hsa-miR-548y	CLIP-seq
MIRT2173430	hsa-miR-559	CLIP-seq
MIRT2173431	hsa-miR-573	CLIP-seq
MIRT790806	hsa-miR-581	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790787	hsa-miR-620	CLIP-seq
MIRT790788	hsa-miR-634	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790790	hsa-miR-646	CLIP-seq
MIRT790808	hsa-miR-654-3p	CLIP-seq
MIRT790809	hsa-miR-655	CLIP-seq
MIRT790791	hsa-miR-660	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790793	hsa-miR-664	CLIP-seq
MIRT2173432	hsa-miR-873	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT790795	hsa-miR-922	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790691	hsa-miR-147	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790730	hsa-miR-3691-5p	CLIP-seq
MIRT790735	hsa-miR-3911	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790766	hsa-miR-4752	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT790789	hsa-miR-644	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790688	hsa-miR-1273d	CLIP-seq
MIRT790689	hsa-miR-1297	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790798	hsa-miR-2054	CLIP-seq
MIRT790705	hsa-miR-26a	CLIP-seq
MIRT790706	hsa-miR-26b	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT790800	hsa-miR-3152-3p	CLIP-seq
MIRT790717	hsa-miR-3158-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT2173410	hsa-miR-3622a-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT790725	hsa-miR-3686	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790801	hsa-miR-374c	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790737	hsa-miR-3976	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790739	hsa-miR-4269	CLIP-seq
MIRT790804	hsa-miR-4280	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790745	hsa-miR-4465	CLIP-seq
MIRT790749	hsa-miR-4514	CLIP-seq
MIRT790759	hsa-miR-4692	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT790764	hsa-miR-4742-5p	CLIP-seq
MIRT790767	hsa-miR-4760-3p	CLIP-seq
MIRT790770	hsa-miR-4778-5p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT2173416	hsa-miR-495	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT790806	hsa-miR-581	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790809	hsa-miR-655	CLIP-seq
MIRT790791	hsa-miR-660	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT2173406	hsa-miR-3117-3p	CLIP-seq
MIRT2173408	hsa-miR-3169	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT2173414	hsa-miR-4759	CLIP-seq
MIRT2173417	hsa-miR-548a-5p	CLIP-seq
MIRT2173418	hsa-miR-548ab	CLIP-seq
MIRT2173419	hsa-miR-548ak	CLIP-seq
MIRT2173420	hsa-miR-548b-5p	CLIP-seq
MIRT2173421	hsa-miR-548c-5p	CLIP-seq
MIRT2173422	hsa-miR-548d-5p	CLIP-seq
MIRT2173423	hsa-miR-548h	CLIP-seq
MIRT2173424	hsa-miR-548i	CLIP-seq
MIRT2173425	hsa-miR-548j	CLIP-seq
MIRT2173426	hsa-miR-548k	CLIP-seq
MIRT2173427	hsa-miR-548l	CLIP-seq
MIRT2173428	hsa-miR-548w	CLIP-seq
MIRT2173429	hsa-miR-548y	CLIP-seq
MIRT2173430	hsa-miR-559	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT2476983	hsa-miR-153	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT2476984	hsa-miR-185	CLIP-seq
MIRT2476985	hsa-miR-186	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790797	hsa-miR-205	CLIP-seq
MIRT790701	hsa-miR-216b	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT2173406	hsa-miR-3117-3p	CLIP-seq
MIRT2173407	hsa-miR-3123	CLIP-seq
MIRT2476986	hsa-miR-3133	CLIP-seq
MIRT790799	hsa-miR-3137	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT2173408	hsa-miR-3169	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT2173410	hsa-miR-3622a-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT2476987	hsa-miR-3667-5p	CLIP-seq
MIRT2476988	hsa-miR-3682-5p	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790740	hsa-miR-4286	CLIP-seq
MIRT2476989	hsa-miR-4306	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT2476990	hsa-miR-4433	CLIP-seq
MIRT2476991	hsa-miR-4459	CLIP-seq
MIRT2476992	hsa-miR-4463	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT2476993	hsa-miR-4494	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790748	hsa-miR-4509	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT2476994	hsa-miR-4644	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT2476995	hsa-miR-4713-5p	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT790763	hsa-miR-4731-3p	CLIP-seq
MIRT2476996	hsa-miR-4738-3p	CLIP-seq
MIRT790765	hsa-miR-4744	CLIP-seq
MIRT2173414	hsa-miR-4759	CLIP-seq
MIRT790768	hsa-miR-4766-5p	CLIP-seq
MIRT2476997	hsa-miR-4768-3p	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT790773	hsa-miR-4801	CLIP-seq
MIRT2173416	hsa-miR-495	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT2476998	hsa-miR-499a-5p	CLIP-seq
MIRT2173417	hsa-miR-548a-5p	CLIP-seq
MIRT2173418	hsa-miR-548ab	CLIP-seq
MIRT2173419	hsa-miR-548ak	CLIP-seq
MIRT2173420	hsa-miR-548b-5p	CLIP-seq
MIRT790783	hsa-miR-548c-3p	CLIP-seq
MIRT2173421	hsa-miR-548c-5p	CLIP-seq
MIRT2173422	hsa-miR-548d-5p	CLIP-seq
MIRT2173423	hsa-miR-548h	CLIP-seq
MIRT2173424	hsa-miR-548i	CLIP-seq
MIRT2173425	hsa-miR-548j	CLIP-seq
MIRT2173426	hsa-miR-548k	CLIP-seq
MIRT2173427	hsa-miR-548l	CLIP-seq
MIRT2173428	hsa-miR-548w	CLIP-seq
MIRT2173429	hsa-miR-548y	CLIP-seq
MIRT2173430	hsa-miR-559	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790808	hsa-miR-654-3p	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790793	hsa-miR-664	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT2476999	hsa-miR-942	CLIP-seq
MIRT790682	hsa-miR-101	CLIP-seq
MIRT790686	hsa-miR-1264	CLIP-seq
MIRT790690	hsa-miR-144	CLIP-seq
MIRT790692	hsa-miR-15a	CLIP-seq
MIRT790693	hsa-miR-15b	CLIP-seq
MIRT790694	hsa-miR-16	CLIP-seq
MIRT2476984	hsa-miR-185	CLIP-seq
MIRT2476985	hsa-miR-186	CLIP-seq
MIRT790697	hsa-miR-195	CLIP-seq
MIRT790797	hsa-miR-205	CLIP-seq
MIRT790701	hsa-miR-216b	CLIP-seq
MIRT790702	hsa-miR-23a	CLIP-seq
MIRT790703	hsa-miR-23b	CLIP-seq
MIRT790704	hsa-miR-23c	CLIP-seq
MIRT790707	hsa-miR-300	CLIP-seq
MIRT790713	hsa-miR-3074-3p	CLIP-seq
MIRT2173406	hsa-miR-3117-3p	CLIP-seq
MIRT2173407	hsa-miR-3123	CLIP-seq
MIRT2476986	hsa-miR-3133	CLIP-seq
MIRT790799	hsa-miR-3137	CLIP-seq
MIRT790715	hsa-miR-3148	CLIP-seq
MIRT2173408	hsa-miR-3169	CLIP-seq
MIRT790719	hsa-miR-324-5p	CLIP-seq
MIRT790720	hsa-miR-337-3p	CLIP-seq
MIRT790722	hsa-miR-361-3p	CLIP-seq
MIRT2173410	hsa-miR-3622a-5p	CLIP-seq
MIRT790723	hsa-miR-3647-3p	CLIP-seq
MIRT2476987	hsa-miR-3667-5p	CLIP-seq
MIRT2476988	hsa-miR-3682-5p	CLIP-seq
MIRT790726	hsa-miR-3689a-5p	CLIP-seq
MIRT790727	hsa-miR-3689b	CLIP-seq
MIRT790728	hsa-miR-3689e	CLIP-seq
MIRT790729	hsa-miR-3689f	CLIP-seq
MIRT790731	hsa-miR-3713	CLIP-seq
MIRT790802	hsa-miR-380	CLIP-seq
MIRT790734	hsa-miR-381	CLIP-seq
MIRT790736	hsa-miR-3936	CLIP-seq
MIRT790738	hsa-miR-424	CLIP-seq
MIRT790740	hsa-miR-4286	CLIP-seq
MIRT2476989	hsa-miR-4306	CLIP-seq
MIRT790741	hsa-miR-431	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT2476990	hsa-miR-4433	CLIP-seq
MIRT2476991	hsa-miR-4459	CLIP-seq
MIRT2476992	hsa-miR-4463	CLIP-seq
MIRT790746	hsa-miR-4489	CLIP-seq
MIRT2476993	hsa-miR-4494	CLIP-seq
MIRT790747	hsa-miR-4501	CLIP-seq
MIRT790748	hsa-miR-4509	CLIP-seq
MIRT790753	hsa-miR-4532	CLIP-seq
MIRT2476994	hsa-miR-4644	CLIP-seq
MIRT790757	hsa-miR-4666-3p	CLIP-seq
MIRT2476995	hsa-miR-4713-5p	CLIP-seq
MIRT790761	hsa-miR-4717-3p	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq
MIRT2476996	hsa-miR-4738-3p	CLIP-seq
MIRT790765	hsa-miR-4744	CLIP-seq
MIRT2173414	hsa-miR-4759	CLIP-seq
MIRT790768	hsa-miR-4766-5p	CLIP-seq
MIRT2476997	hsa-miR-4768-3p	CLIP-seq
MIRT790769	hsa-miR-4775	CLIP-seq
MIRT790771	hsa-miR-4793-5p	CLIP-seq
MIRT790772	hsa-miR-4794	CLIP-seq
MIRT2173416	hsa-miR-495	CLIP-seq
MIRT790774	hsa-miR-497	CLIP-seq
MIRT2476998	hsa-miR-499a-5p	CLIP-seq
MIRT2173417	hsa-miR-548a-5p	CLIP-seq
MIRT2173418	hsa-miR-548ab	CLIP-seq
MIRT2173419	hsa-miR-548ak	CLIP-seq
MIRT2173420	hsa-miR-548b-5p	CLIP-seq
MIRT790783	hsa-miR-548c-3p	CLIP-seq
MIRT2173421	hsa-miR-548c-5p	CLIP-seq
MIRT2173422	hsa-miR-548d-5p	CLIP-seq
MIRT2173423	hsa-miR-548h	CLIP-seq
MIRT2173424	hsa-miR-548i	CLIP-seq
MIRT2173425	hsa-miR-548j	CLIP-seq
MIRT2173426	hsa-miR-548k	CLIP-seq
MIRT2173427	hsa-miR-548l	CLIP-seq
MIRT2173428	hsa-miR-548w	CLIP-seq
MIRT2173429	hsa-miR-548y	CLIP-seq
MIRT2173430	hsa-miR-559	CLIP-seq
MIRT790786	hsa-miR-582-5p	CLIP-seq
MIRT790808	hsa-miR-654-3p	CLIP-seq
MIRT790792	hsa-miR-662	CLIP-seq
MIRT790793	hsa-miR-664	CLIP-seq
MIRT790794	hsa-miR-892b	CLIP-seq
MIRT2476999	hsa-miR-942	CLIP-seq
MIRT790742	hsa-miR-4422	CLIP-seq
MIRT790762	hsa-miR-4719	CLIP-seq

Transcription factors

Show/Hide all(11)

Transcription factor	Regulation	Reference
CTCF	Activation	11706010;9407128
CTCF	Repression	11706010
ETS2	Unknown	12890557
HDAC9	Unknown	20145244
JUN	Unknown	8015372
NFIL3	Unknown	22947103
SP1	Activation	15673661
SP1	Unknown	8015372
STAT1	Unknown	9841227
TBP	Unknown	8015372
TFAP2A	Unknown	17651731

Show/Hide all(298)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IGI	21803450
GO:0001664	Function	G protein-coupled receptor binding	IPI	11316806
GO:0001774	Process	Microglial cell activation	IDA	18723082
GO:0001774	Process	Microglial cell activation	IGI	15457210, 22406537
GO:0001878	Process	Response to yeast	IMP	20209079
GO:0002265	Process	Astrocyte activation involved in immune response	IGI	23152628
GO:0003677	Function	DNA binding	ISS
GO:0003682	Function	Chromatin binding	IGI	19057576
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IDA	10652580
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005102	Function	Signaling receptor binding	IBA
GO:0005102	Function	Signaling receptor binding	IPI	19849849, 23921129, 29518356
GO:0005109	Function	Frizzled binding	IPI	18234671
GO:0005158	Function	Insulin receptor binding	IPI	19406747
GO:0005178	Function	Integrin binding	IDA	21126803
GO:0005515	Function	Protein binding	IPI	2119582, 8626687, 8855266, 8887653, 9223340, 9338779, 9461550, 9774383, 10049767, 10081969, 10673326, 10677483, 10681545, 11083918, 11238726, 11278849, 11297421, 11350084, 11724784, 11756426, 11877420, 12054541, 12878203, 12901838, 14527950, 14557245, 14983046, 15615705, 15896298, 15
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470
GO:0005615	Component	Extracellular space	IDA	29518356
GO:0005615	Component	Extracellular space	IDA	20164328, 23921129, 24827165, 26005850
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	IMP	23640054
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IGI	19057576
GO:0005641	Component	Nuclear envelope lumen	IDA	21989385
GO:0005737	Component	Cytoplasm	IDA	11689470
GO:0005737	Component	Cytoplasm	IDA	18509662, 18723082
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IGI	19808651
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IDA	23525105
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005764	Component	Lysosome	IDA	21289173, 23152628
GO:0005768	Component	Endosome	IDA	18353773
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005769	Component	Early endosome	IDA	14527950, 26005850
GO:0005769	Component	Early endosome	IEA
GO:0005769	Component	Early endosome	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	14527950
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	14527950, 20427278
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	ISS
GO:0005796	Component	Golgi lumen	TAS
GO:0005798	Component	Golgi-associated vesicle	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11689470
GO:0005886	Component	Plasma membrane	IDA	12805363, 20164328, 20427278, 28164773, 28855300
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10806211
GO:0005905	Component	Clathrin-coated pit	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IGI	19057576
GO:0006417	Process	Regulation of translation	ISS
GO:0006878	Process	Intracellular copper ion homeostasis	ISS
GO:0006897	Process	Endocytosis	IEA
GO:0006897	Process	Endocytosis	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	11160457
GO:0007186	Process	G protein-coupled receptor signaling pathway	IGI	11160457
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IGI	22500019
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	18723082, 20141570
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IGI	20141570
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007268	Process	Chemical synaptic transmission	IDA	18216187
GO:0007409	Process	Axonogenesis	IBA
GO:0007409	Process	Axonogenesis	ISS
GO:0007417	Process	Central nervous system development	IBA
GO:0007611	Process	Learning or memory	IGI	15457210, 19118188, 19587288, 20164328, 20445063, 21113149, 24012003, 24052308, 26005850
GO:0007611	Process	Learning or memory	IMP	11880515, 15457210
GO:0007612	Process	Learning	IMP	11140684
GO:0007613	Process	Memory	IGI	11140685, 19118188
GO:0007617	Process	Mating behavior	ISS
GO:0007626	Process	Locomotory behavior	ISS
GO:0008088	Process	Axo-dendritic transport	ISS
GO:0008201	Function	Heparin binding	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	22944668
GO:0008306	Process	Associative learning	IGI	19118188
GO:0008344	Process	Adult locomotory behavior	ISS
GO:0008542	Process	Visual learning	ISS
GO:0009897	Component	External side of plasma membrane	IDA	15537891
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IDA	7593229, 18353773
GO:0009986	Component	Cell surface	IEA
GO:0009986	Component	Cell surface	NAS	15457210
GO:0010288	Process	Response to lead ion	IEA
GO:0010468	Process	Regulation of gene expression	IGI	21857966, 26200696
GO:0010468	Process	Regulation of gene expression	IMP	29274751
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	26006083
GO:0010628	Process	Positive regulation of gene expression	IGI	20037584, 22198949, 23164821, 27853422, 28008308, 29061364
GO:0010628	Process	Positive regulation of gene expression	IMP	15457210, 23164821, 27853422
GO:0010628	Process	Positive regulation of gene expression	TAS	23164821
GO:0010629	Process	Negative regulation of gene expression	IDA	26006083
GO:0010629	Process	Negative regulation of gene expression	IGI	18234671, 22198949, 27853422, 28008308, 29061364
GO:0010629	Process	Negative regulation of gene expression	TAS	20005821, 21803450
GO:0010996	Process	Response to auditory stimulus	IGI	19118188
GO:0014005	Process	Microglia development	IGI	22198949
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	ISS
GO:0016199	Process	Axon midline choice point recognition	ISS
GO:0016322	Process	Neuron remodeling	ISS
GO:0016358	Process	Dendrite development	ISS
GO:0016504	Function	Peptidase activator activity	IEA
GO:0019722	Process	Calcium-mediated signaling	IDA	11160457
GO:0019722	Process	Calcium-mediated signaling	IGI	11160457
GO:0019731	Process	Antibacterial humoral response	IDA	20209079
GO:0019732	Process	Antifungal humoral response	IMP	20209079
GO:0019899	Function	Enzyme binding	IPI	17112471, 24499793
GO:0030111	Process	Regulation of Wnt signaling pathway	IC	21857966
GO:0030198	Process	Extracellular matrix organization	ISS
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IDA	17251419
GO:0030425	Component	Dendrite	IDA	24012003
GO:0030426	Component	Growth cone	IEA
GO:0030546	Function	Signaling receptor activator activity	IBA
GO:0030546	Function	Signaling receptor activator activity	IDA	11316806
GO:0030549	Function	Acetylcholine receptor activator activity	TAS	19118188
GO:0031091	Component	Platelet alpha granule	IEA
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031175	Process	Neuron projection development	ISS
GO:0031175	Process	Neuron projection development	TAS	27853422
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031583	Process	Phospholipase D-activating G protein-coupled receptor signaling pathway	IDA	18723082
GO:0031901	Component	Early endosome membrane	IDA	16174740
GO:0031904	Component	Endosome lumen	TAS	24305806
GO:0032588	Component	Trans-Golgi network membrane	TAS
GO:0032590	Component	Dendrite membrane	IDA	15537891
GO:0032590	Component	Dendrite membrane	TAS	20032460
GO:0032722	Process	Positive regulation of chemokine production	IGI	22406537
GO:0032729	Process	Positive regulation of type II interferon production	IGI	17255335
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IGI	22406537
GO:0032755	Process	Positive regulation of interleukin-6 production	IGI	22406537
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IGI	12808450, 22198949, 22406537, 29061364
GO:0032930	Process	Positive regulation of superoxide anion generation	IGI	11316806
GO:0032991	Component	Protein-containing complex	IDA	9228033
GO:0032991	Component	Protein-containing complex	IPI	18568035
GO:0033130	Function	Acetylcholine receptor binding	IPI	10681545
GO:0034121	Process	Regulation of toll-like receptor signaling pathway	IGI	20037584
GO:0034185	Function	Apolipoprotein binding	IPI	9211985, 22138302
GO:0034361	Component	Very-low-density lipoprotein particle	IPI	9211985
GO:0034362	Component	Low-density lipoprotein particle	IPI	9211985
GO:0034363	Component	Intermediate-density lipoprotein particle	IDA	22138302
GO:0034363	Component	Intermediate-density lipoprotein particle	IPI	9211985
GO:0034364	Component	High-density lipoprotein particle	IDA	22138302
GO:0034364	Component	High-density lipoprotein particle	IPI	9211985
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	ISS
GO:0040014	Process	Regulation of multicellular organism growth	ISS
GO:0042056	Function	Chemoattractant activity	IGI	11316806
GO:0042157	Process	Lipoprotein metabolic process	IC	9211985
GO:0042802	Function	Identical protein binding	IPI	16193067, 16286452, 16492752, 17116874, 18059284, 18463291, 18483195, 18499799, 18559859, 18805418, 19164538, 19242475, 19264960, 19304802, 19458258, 19549187, 19706468, 19706519, 19754881, 19805234, 19841277, 20133839, 20133875, 20212142, 20308552, 20383142, 20573181, 20818335, 211
GO:0042803	Function	Protein homodimerization activity	IPI	15447668, 18568035, 22179788, 23386614
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IDA	25390368
GO:0043005	Component	Neuron projection	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	27241555
GO:0043065	Process	Positive regulation of apoptotic process	IDA	11689470
GO:0043065	Process	Positive regulation of apoptotic process	IGI	11689470
GO:0043065	Process	Positive regulation of apoptotic process	TAS	22500019
GO:0043197	Component	Dendritic spine	IDA	11988176
GO:0043198	Component	Dendritic shaft	IDA	11988176
GO:0043204	Component	Perikaryon	IEA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043395	Function	Heparan sulfate proteoglycan binding	IMP	21289173
GO:0043410	Process	Positive regulation of MAPK cascade	IGI	15190117
GO:0043410	Process	Positive regulation of MAPK cascade	NAS	22500019
GO:0043410	Process	Positive regulation of MAPK cascade	TAS	11404397
GO:0043525	Process	Positive regulation of neuron apoptotic process	IDA	29371969
GO:0043525	Process	Positive regulation of neuron apoptotic process	IGI	23164821
GO:0044297	Component	Cell body	IDA	25390368
GO:0044304	Component	Main axon	IEA
GO:0045087	Process	Innate immune response	IMP	20209079
GO:0045121	Component	Membrane raft	IBA
GO:0045121	Component	Membrane raft	IDA	24499793
GO:0045202	Component	Synapse	IDA	11988176
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IGI	20037584
GO:0045666	Process	Positive regulation of neuron differentiation	IGI	15190117
GO:0045745	Process	Positive regulation of G protein-coupled receptor signaling pathway	IDA	11316806
GO:0045752	Process	Positive regulation of Toll signaling pathway	IGI	20037584
GO:0045821	Process	Positive regulation of glycolytic process	IGI	29061364
GO:0045931	Process	Positive regulation of mitotic cell cycle	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	23921129
GO:0046330	Process	Positive regulation of JNK cascade	IGI	23921129
GO:0046872	Function	Metal ion binding	IEA
GO:0046875	Function	Ephrin receptor binding	IPI	21113149
GO:0046914	Function	Transition metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IPI	18568035, 19660551
GO:0048018	Function	Receptor ligand activity	IDA	16174740, 29518356
GO:0048143	Process	Astrocyte activation	IDA	18723082
GO:0048143	Process	Astrocyte activation	IGI	15457210, 20445063
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	IGI	23921129
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20427278
GO:0048669	Process	Collateral sprouting in absence of injury	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IMP	29961672
GO:0050750	Function	Low-density lipoprotein particle receptor binding	ISS
GO:0050786	Function	RAGE receptor binding	IPI	22406537
GO:0050803	Process	Regulation of synapse structure or activity	ISS
GO:0050808	Process	Synapse organization	IGI	19587288, 24012003
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	20209079
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	20209079
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IGI	22500019
GO:0050867	Process	Positive regulation of cell activation	NAS	11689470
GO:0050890	Process	Cognition	ISS
GO:0050918	Process	Positive chemotaxis	IEA
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IDA	25015123
GO:0051044	Process	Positive regulation of membrane protein ectodomain proteolysis	IGI	25015123
GO:0051087	Function	Protein-folding chaperone binding	IPI	9228033, 23106396
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IEA
GO:0051247	Process	Positive regulation of protein metabolic process	IMP	11404397
GO:0051247	Process	Positive regulation of protein metabolic process	ISS
GO:0051247	Process	Positive regulation of protein metabolic process	TAS	20005821
GO:0051260	Process	Protein homooligomerization	IPI	15447668, 18602473, 22179788, 23386614
GO:0051262	Process	Protein tetramerization	IMP	19660551
GO:0051262	Process	Protein tetramerization	IPI	19660551
GO:0051425	Function	PTB domain binding	IPI	12805363
GO:0051580	Process	Regulation of neurotransmitter uptake	IGI	19118188
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	NAS	22500019
GO:0055037	Component	Recycling endosome	ISS
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IDA	26005850
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IMP	20209079
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070206	Process	Protein trimerization	IMP	19660551
GO:0070206	Process	Protein trimerization	IPI	19660551
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	18723082, 20141570
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IGI	15457210, 20141570
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070381	Component	Endosome to plasma membrane transport vesicle	IDA	26005850
GO:0070555	Process	Response to interleukin-1	IEA
GO:0070555	Process	Response to interleukin-1	ISS
GO:0070851	Function	Growth factor receptor binding	IEA
GO:0071280	Process	Cellular response to copper ion	IEA
GO:0071287	Process	Cellular response to manganese ion	IEA
GO:0071320	Process	Cellular response to cAMP	IEA
GO:0071874	Process	Cellular response to norepinephrine stimulus	IEA
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IDA	11160457
GO:0090026	Process	Positive regulation of monocyte chemotaxis	IGI	11160457
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	18234671
GO:0097060	Component	Synaptic membrane	IDA	17308309
GO:0097449	Component	Astrocyte projection	IEA
GO:0097645	Function	Amylin binding	TAS	22500019
GO:0098793	Component	Presynapse	IDA	25390368
GO:0098794	Component	Postsynapse	IDA	25390368
GO:0098815	Process	Modulation of excitatory postsynaptic potential	IGI	19118188, 20974225
GO:0098989	Process	NMDA selective glutamate receptor signaling pathway	TAS	17360908
GO:0098992	Component	Neuronal dense core vesicle	IEA
GO:0106003	Component	Amyloid-beta complex	IDA	33239400
GO:0106003	Component	Amyloid-beta complex	IMP	23640054
GO:0106003	Component	Amyloid-beta complex	IPI	22179788, 23386614
GO:0106003	Component	Amyloid-beta complex	TAS	22500019
GO:0120283	Function	Protein serine/threonine kinase binding	IPI	24305806
GO:0140677	Function	Molecular function activator activity	IEA
GO:0141137	Process	Positive regulation of gene expression, epigenetic	IGI	19057576
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IDA	22500019
GO:0150003	Process	Regulation of spontaneous synaptic transmission	IGI	15457210
GO:1900181	Process	Negative regulation of protein localization to nucleus	IGI	18234671
GO:1900221	Process	Regulation of amyloid-beta clearance	IMP	19057576
GO:1900272	Process	Negative regulation of long-term synaptic potentiation	IGI	15457210, 16636059, 19118188
GO:1900273	Process	Positive regulation of long-term synaptic potentiation	IGI	19118188, 20974225
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IDA	22406537
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IGI	15457210
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	29961672
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	IDA	21883149
GO:1902894	Process	Negative regulation of miRNA transcription	IDA	24827165, 25152461
GO:1902950	Process	Regulation of dendritic spine maintenance	IGI	23921129
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IGI	22406537
GO:1903381	Process	Regulation of endoplasmic reticulum stress-induced neuron intrinsic apoptotic signaling pathway	IGI	23921129
GO:1903523	Process	Negative regulation of blood circulation	IGI	12808450
GO:1904022	Process	Positive regulation of G protein-coupled receptor internalization	IDA	18723082
GO:1904399	Function	Heparan sulfate binding	TAS	21289173
GO:1904472	Process	Positive regulation of endothelin production	IGI	12808450
GO:1904591	Process	Positive regulation of protein import	IDA	23164821
GO:1904646	Process	Cellular response to amyloid-beta	IDA	23459077, 29518356
GO:1904646	Process	Cellular response to amyloid-beta	IDA	29518356
GO:1904646	Process	Cellular response to amyloid-beta	IGI	23152628, 23921129
GO:1905606	Process	Regulation of presynapse assembly	IDA	19726636
GO:1905606	Process	Regulation of presynapse assembly	IMP	19726636
GO:1905898	Process	Positive regulation of response to endoplasmic reticulum stress	IDA	21803450
GO:1905906	Process	Regulation of amyloid fibril formation	IGI	11140685
GO:1905908	Process	Positive regulation of amyloid fibril formation	IMP	19660551
GO:1905945	Process	Regulation of response to calcium ion	ISS
GO:1990000	Process	Amyloid fibril formation	EXP	9737846, 26138908
GO:1990000	Process	Amyloid fibril formation	IMP	25620700
GO:1990090	Process	Cellular response to nerve growth factor stimulus	IEA
GO:1990535	Process	Neuron projection maintenance	IGI	20445063
GO:1990761	Component	Growth cone lamellipodium	IEA
GO:1990777	Component	Lipoprotein particle	IDA	22138302
GO:1990812	Component	Growth cone filopodium	IEA
GO:2000406	Process	Positive regulation of T cell migration	IMP	19660551
GO:2000463	Process	Positive regulation of excitatory postsynaptic potential	IGI	19118188
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IGI	20037584

MIM	HGNC	e!Ensembl
104760	620	ENSG00000142192

Protein

UniProt ID

P05067

Protein name

Amyloid-beta precursor protein (APP) (ABPP) (APPI) (Alzheimer disease amyloid A4 protein homolog) (Alzheimer disease amyloid protein) (Amyloid precursor protein) (Amyloid-beta (A4) precursor protein) (Amyloid-beta A4 protein) (Cerebral vascular amyloid pe

Protein function

Functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Interaction between APP molecules on neighboring cells promotes synaptogenesis (P

PDB

1AAP , 1AMB , 1AMC , 1AML , 1BA4 , 1BA6 , 1BJB , 1BJC , 1BRC , 1CA0 , 1HZ3 , 1IYT , 1MWP , 1OWT , 1QCM , 1QWP , 1QXC , 1QYT , 1TAW , 1TKN , 1X11 , 1Z0Q , 1ZE7 , 1ZE9 , 1ZJD , 2BEG , 2BP4 , 2FJZ , 2FK1 , 2FK2 , 2FK3 , 2FKL , 2FMA , 2G47 , 2IPU , 2LFM , 2LLM , 2LMN , 2LMO , 2LMP , 2LMQ , 2LNQ , 2LOH , 2LP1 , 2LZ3 , 2LZ4 , 2M4J , 2M9R , 2M9S , 2MGT , 2MJ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02177	APP_N	31 → 131	Amyloid A4 N-terminal heparin-binding	Domain
PF12924	APP_Cu_bd	132 → 188	Copper-binding of amyloid precursor, CuBD	Domain
PF00014	Kunitz_BPTI	290 → 342	Kunitz/Bovine pancreatic trypsin inhibitor domain	Domain
PF12925	APP_E2	366 → 548	E2 domain of amyloid precursor protein	Domain
PF03494	Beta-APP	675 → 713	Beta-amyloid peptide (beta-APP)	Family
PF10515	APP_amyloid	716 → 766	Beta-amyloid precursor protein C-terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain and in cerebrospinal fluid (at protein level) (PubMed:2649245). Expressed in all fetal tissues examined with highest levels in brain, kidney, heart and spleen. Weak expression in liver. In adult brain, highest ex

Sequence

MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN

Sequence length

770

Interactions

View interactions

	KEGG		Reactome
	Serotonergic synapse Alzheimer disease Pathways of neurodegeneration - multiple diseases		Platelet degranulation ECM proteoglycans Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) G alpha (q) signalling events G alpha (i) signalling events Lysosome Vesicle Biogenesis Formyl peptide receptors bind formyl peptides and many other ligands TAK1 activates NFkB by phosphorylation and activation of IKKs complex The NLRP3 inflammasome Advanced glycosylation endproduct receptor signaling Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models Post-translational protein phosphorylation TRAF6 mediated NF-kB activation Insertion of tail-anchored proteins into the endoplasmic reticulum membrane Purinergic signaling in leishmaniasis infection Amyloid fiber formation

Show/Hide Causal Diseases (3)

Disease merge term	Disease name	dbSNP ID	References
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
alzheimer disease	Alzheimer disease	rs63750851, rs63750734, rs63750671, rs63751039, rs281865161, rs63750973, rs63749810, rs63750579, rs63750066, rs63750643, rs63750264, rs193922916	N/A
Alzheimer disease	alzheimer disease type 1, Primary degenerative dementia of the Alzheimer type, presenile onset	rs63749964, rs63750671, rs63751039, rs281865161, rs63750973, rs63750066, rs63750643, rs63750264, rs63750399, rs63750734	N/A
Cerebral amyloid angiopathy	cerebral amyloid angiopathy, app-related	rs63750579, rs63750066, rs63750921, rs63750264	N/A

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Lymphocytic Leukemia	Chronic lymphocytic leukemia	N/A	N/A	GWAS
vascular dementia	Vascular dementia	N/A	N/A	ClinVar

Show/Hide Text Mining Associations (340)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
AA amyloidosis	Associate	10956649, 12480937, 12787077, 15257727, 17170111, 1837142, 18508486, 20228223, 21681798, 21832091, 23415897, 23505467, 23790381, 24028142, 24140343 View all (34 more)
AA amyloidosis	Stimulate	17332749, 17653279, 24936411, 32250387, 32385803, 34593890
AA amyloidosis	Inhibit	29164798, 33933117, 35862308
Acquired Immunodeficiency Syndrome	Associate	19706884, 8403502
Acute cholinergic dysautonomia	Associate	25732182
Acute Coronary Syndrome	Associate	39824235
Acute Disease	Associate	32385803
Adrenal Cortex Diseases	Stimulate	31437719
AIDS Associated Nephropathy	Associate	23018443
Albinism Oculocutaneous	Associate	21408230
Alcohol Amnestic Disorder	Associate	32057937
Alzheimer Disease	Associate	10037734, 10079962, 10097173, 10098849, 10205007, 10220456, 10373494, 10389030, 10461887, 10599054, 10631141, 10677483, 10734132, 10861242, 10880397 View all (1385 more)
Alzheimer Disease	Stimulate	10409650, 12048239, 12135764, 14559775, 15509549, 16508101, 16524370, 16608822, 16763046, 17158800, 17332749, 17346237, 17620492, 17675576, 18234110 View all (109 more)
Alzheimer Disease	Inhibit	11404470, 21116050, 21987546, 22343824, 23093013, 25072319, 26940242, 28455519, 30526652, 32114428, 32911327, 33032662, 33348885, 33370284, 33837271, 34342183, 37173305, 38615405 View all (3 more)
Alzheimer disease type 1	Associate	22101948, 22491860, 30045758
Alzheimer's disease without Neurofibrillary tangles	Associate	32722745
Amyloid angiopathy	Associate	16027166, 17448150, 20228223, 23018443, 33278904, 36373322
Amyloid Neuropathies Familial	Associate	20228223, 24028142
Amyloidosis	Associate	10920030, 11004129, 12408229, 12787077, 18055545, 19189048, 23686534, 26332787, 26448035, 31600059, 39341941
Amyloidosis Cerebroarterial App Related	Associate	23634215, 28557134, 37603921, 9048759, 9422365
Amyotrophic Lateral Sclerosis	Associate	19478559, 30572951, 36952379, 39278909
Amyotrophic lateral sclerosis 1	Associate	36707813
Angioedema	Associate	16175507
Aphasia Primary Progressive	Associate	23946416, 30635491, 30765195, 33262228, 35487701
Apnea	Inhibit	24439479
Arthritis Rheumatoid	Associate	39342401
Asthma	Inhibit	12061423
Asthma	Associate	29956778
Astrocytoma	Associate	36982288, 38148047
Ataxia Telangiectasia	Associate	2136770, 36833366
Atherosclerosis	Associate	36448495, 37541842
Atrophy	Associate	20802215, 25678559, 25990306, 26843008, 27521573, 30686901, 31370031, 32057937, 33262228, 33548794, 36773106, 37061167
Atrophy	Stimulate	30765195, 31437719, 40174910
Attention Deficit and Disruptive Behavior Disorders	Stimulate	31915189
Attention Deficit Disorder with Hyperactivity	Stimulate	39173065
Aural Atresia Congenital	Associate	19162185
Autistic Disorder	Associate	24252310, 32345355
Autoimmune Diseases	Associate	34710239
Autoimmune Lymphoproliferative Syndrome	Associate	11588044
Basal Ganglia Diseases	Associate	15148385
beta Thalassemia	Associate	9236226
Biliary Atresia	Associate	39341941
Blood Coagulation Disorders	Associate	36448495
Brain Concussion	Associate	34663629
Brain Damage Chronic	Associate	24843230
Brain Diseases	Associate	31688040, 33303945, 33933117, 7619525
Brain Edema	Associate	35569976
Brain Injuries	Associate	25575135
Brain Injuries Traumatic	Associate	19326964, 28557010, 30250223, 34663629
Breast Neoplasms	Associate	20678196, 23889773, 25043050, 30108157, 31746365, 40178903, 9434630
Burkitt Lymphoma	Associate	12967475
Cafe au Lait Spots	Associate	16482197
Carcinogenesis	Associate	30108157
Carcinoma Hepatocellular	Associate	18837082, 27507654, 32133800
Carcinoma Non Small Cell Lung	Associate	25502341
Carcinoma Squamous Cell	Associate	17651731, 39741285
Cardiomyopathies	Associate	35938548
Cardiomyopathy Hypertrophic	Associate	37628806
Cardiovascular Diseases	Associate	35938548
Cataract	Associate	22984439
Cataract Age Related Nuclear	Associate	29386875
Cataract Congenital with Mental Impairment and Dentate Gyrus Atrophy	Associate	31437719
Celiac Disease	Associate	33559929, 33654213
Cell Transformation Neoplastic	Associate	17540176, 29328367
Cerebral Amyloid Angiopathy	Associate	10800967, 11004129, 11441013, 11580253, 12163376, 12753080, 12754271, 12754344, 15814793, 15975076, 18055545, 18597778, 19061884, 19162185, 19385666 View all (49 more)
Cerebral Amyloid Angiopathy	Inhibit	19743453
Cerebral Amyloid Angiopathy Familial	Associate	10734132, 10800967, 18055545, 19189048, 32518112, 33805778, 8644866, 8955370
Cerebral Hemorrhage	Associate	10821838, 10861242, 11004129, 16027166, 18413473, 19770225, 22156599, 33918046, 8610157
Cerebral Small Vessel Diseases	Associate	19153374, 25355827, 37950256
Cerebrovascular Disorders	Associate	25948718, 30576228, 32518112
Choroidal Effusions	Associate	35940900
Chromosome Aberrations	Associate	33892504
Chronic Traumatic Encephalopathy	Associate	25943889, 30563563
Cognition Disorders	Associate	17601350, 19346482, 20338079, 20414590, 20697031, 21035623, 21280088, 21526197, 21551363, 22637583, 22640423, 22695614, 22965806, 23100439, 23474040 View all (89 more)
Cognition Disorders	Stimulate	24843230, 28468845, 34218796, 39670385
Cognition Disorders	Inhibit	25072319, 29415768
Cognitive Dysfunction	Associate	20338079, 20541286, 21280088, 23635404, 24475133, 25040401, 25288138, 26221954, 26843008, 26940242, 27229352, 27521573, 27748454, 28034305, 28634213 View all (19 more)
Cognitive Dysfunction	Stimulate	21700583, 23613741, 36773106, 39827005, 39940679
Cognitive Dysfunction	Inhibit	37742656
Colorectal Neoplasms	Associate	26074693, 35962130
Coronary Artery Disease	Associate	35938548
Corticobasal Degeneration	Associate	21455839
COVID 19	Associate	34757528, 35938548
Craniocerebral Trauma	Associate	10079962, 19542221
Creutzfeldt Jakob Disease Sporadic	Associate	18349519
Creutzfeldt Jakob Syndrome	Associate	17849360, 27016065, 28349199
Crohn Disease	Stimulate	1424287
Crohn Disease	Associate	32724827, 40182599
Cystic Fibrosis	Associate	14525626
Cytochrome c Oxidase Deficiency	Inhibit	19350381
Death	Associate	10934205, 12016588, 30922415, 37100873
Delirium	Associate	39210294
Dementia	Associate	10220456, 10631141, 12058030, 15983050, 16027166, 17254013, 17344400, 17620492, 19221430, 19571732, 19770225, 20663017, 21193246, 21297263, 21841249 View all (39 more)
Dementia	Stimulate	31849332
Dementia familial Danish	Associate	20228223, 21841249, 36102248
Dental Caries	Associate	33912975
Dental Plaque	Associate	11606623, 12163376, 22214483, 34918018, 35528169
Dental Plaque	Stimulate	22952038, 35598043
Depressive Disorder	Inhibit	19812466
Depressive Disorder	Associate	23928361, 31931428
Depressive Disorder	Stimulate	36040555, 37258256
Depressive Disorder Major	Associate	30445590
dermatophilosis	Associate	34319632
Diabetes Complications	Associate	20943659
Diabetes Mellitus	Associate	17613531, 19896952, 21185309, 36374264
Diabetes Mellitus Type 1	Associate	18316396, 24130366, 33832546, 37506364
Diabetes Mellitus Type 2	Associate	22174920, 22500019, 28684415
Diffuse Neurofibrillary Tangles with Calcification	Stimulate	20191120, 37735227
Diffuse Neurofibrillary Tangles with Calcification	Associate	22968369, 27532054, 27718298, 27979356, 30040735, 31884473, 32170138, 32846925, 33002038, 33097630
Disease	Associate	24949887, 35805926
Distal myopathy Nonaka type	Associate	23472144
Distal myopathy Nonaka type	Stimulate	9546349
Down Syndrome	Associate	10051452, 10880397, 15255950, 16608822, 16685645, 16904243, 19542221, 19571732, 20502642, 21273664, 21958962, 22009041, 22344463, 23102120, 24927707 View all (30 more)
Down Syndrome	Stimulate	17620492, 21116050, 24888381, 30031727, 30359879, 30902060, 34462463, 7724603, 9173910
Drug Related Side Effects and Adverse Reactions	Associate	10934205, 11278849, 14754886, 15459202, 15814793, 17028131, 17344400, 21267410, 21388376, 21832091, 21949245, 22174920, 22385841, 22403062, 22502767 View all (36 more)
Drug Related Side Effects and Adverse Reactions	Stimulate	12107175, 12558989, 12716908, 15857408, 17332749, 19363261, 19558452, 20490276, 20521393, 23134284, 23305945, 23864927, 24048171, 24448790, 24915567 View all (16 more)
Ectodermal Dysplasia	Associate	37379733
Elejalde Disease	Stimulate	30403186
Encephalitis	Associate	14997933
Epilepsies Myoclonic	Stimulate	31831060
Epilepsy	Associate	22702962, 37541842, 38289539, 7931344
Epilepsy Absence	Stimulate	30152135
Epilepsy Temporal Lobe	Associate	31834353
Essential Hypertension	Associate	36941702
Extranodal Extension	Associate	8313898
Fatigue Syndrome Chronic	Associate	39394558
Fever	Inhibit	33002038
Fibrocartilaginous embolism	Associate	36586468
Fibrosis	Associate	39341941
Fibrous Dysplasia Polyostotic	Associate	28827283
Focal cortical dysplasia of Taylor	Associate	23586324
Fragile X Syndrome	Associate	23134465
Frailty	Associate	33336223
Frailty	Inhibit	40399764
Frontotemporal Dementia	Associate	20802215, 24041307, 30981993, 40055834
Frontotemporal Lobar Degeneration	Associate	16421130, 18458217, 23269595, 32039841
Gait Ataxia	Associate	27869301
Gastrointestinal Diseases	Associate	33048222
Genetic Diseases Inborn	Associate	18602473, 20452985, 21267410, 22778873
Gerstmann Straussler Scheinker Disease	Associate	30394185
Glioblastoma	Associate	35797221, 38148047, 7592834, 8077213
Glioma	Associate	38148047, 40595248
Gliosis	Associate	25707004, 26553227, 33749648
Glomerulonephritis IGA	Associate	9893119
Glucose Intolerance	Associate	31796668
Graft vs Host Disease	Inhibit	27724812
Graft vs Host Disease	Associate	32241852
Growth Factors Combined Defect of	Associate	12857759, 15210705
Growth Hormone Deficiency With Pituitary Anomalies	Associate	28349199
Head and Neck Neoplasms	Associate	10079962
Heart Diseases	Associate	20080541, 27908343, 38165363
Hematologic Neoplasms	Associate	26659918
Hemolysis	Associate	36448495
Hemorrhage	Associate	11004129, 19770225, 20576603, 21707819, 22695614
Hemorrhagic Stroke	Associate	10800967, 10821838, 12753080, 17448150
Herpes Zoster	Stimulate	32385803
Hip Injuries	Associate	35356751
Hippocampal Sclerosis	Associate	21889115
HIV Infections	Associate	21551363, 23018443, 25446617, 30152135, 31688040, 32326569, 33813555
Huntington Disease	Associate	25043050, 32804976
Hydrocephalus	Stimulate	22186713, 28212403
Hydrocephalus Normal Pressure	Inhibit	27472944
Hydrocephalus Normal Pressure	Associate	31849332, 33720890
Hypercholesterolemia	Stimulate	31929164
Hyperglycemia	Stimulate	23894546, 26842741
Hyperglycemic Hyperosmolar Nonketotic Coma	Stimulate	36073820
Hypertension	Associate	31831374, 36374264, 36941702
Hypotension	Associate	23276181
Hypoxia	Associate	12050157
Hypoxia	Stimulate	18326038, 26924229, 30355438
Hypoxia Brain	Associate	26924229
Ileitis	Associate	1424287
Immunologic Deficiency Syndromes	Stimulate	21515373
Infections	Associate	34710239, 34759019, 35938548, 37100873
Inflammation	Associate	12050157, 12475184, 1424287, 18276775, 18483477, 21329555, 22898493, 23186989, 23253155, 23943781, 26553227, 28428554, 28984607, 29961672, 31600059 View all (11 more)
Inflammation	Stimulate	19162185, 19694428, 22580042, 24036938, 26650044, 28245546, 29671417, 30736391, 31253822, 33024077, 33352944, 33374505, 34982643, 37062307, 37110558, 37857668, 38138438, 9065490 View all (3 more)
Insomnia Fatal Familial	Associate	39716111
Insulin Resistance	Associate	18483477, 22297646, 27207326, 33267804, 33832546
Insulin Resistance	Stimulate	27079723
Intellectual Disability	Stimulate	23102120
Intracranial Hemorrhages	Associate	25828868
Intrauterine Growth Retardation Metaphyseal Dysplasia Adrenal Hypoplasia Congenita And Genital Anomalies	Associate	34807243
Ischemia	Stimulate	22695614
Islet cell tumor syndrome	Associate	24130366
Keratosis	Associate	29487944
Kuru	Associate	30394185
Leprosy	Associate	7943169
Leprosy Tuberculoid	Associate	24843230
Leukemia	Associate	32241852
Leukemia Myeloid Acute	Associate	23179400
Leukemia T Cell	Associate	2836865
Leukemic Infiltration	Stimulate	23179400
Leukoencephalopathies	Associate	23762308, 25355827, 27614114, 35351867, 38165363, 38353984
Lewy Body Disease	Associate	10557341, 19759000, 22773458, 23133543, 25575135, 26527105, 28269775, 28800743, 37463072, 40051075
Lewy Body Disease	Inhibit	31601267
Lewy Body Disease	Stimulate	35563582
Liver Cirrhosis	Associate	39341941
Lymphocytosis	Associate	37160316
Lymphohistiocytosis Hemophagocytic	Associate	10498609
Lymphoma	Associate	20423568
Lymphoma T Cell Cutaneous	Associate	36833366
Lysosomal Storage Diseases	Associate	22477259, 28413178
Macular Degeneration	Associate	22382405, 24036938, 26467741, 28726777, 30849957, 31095924, 33374505, 37110558
Malformations of Cortical Development	Associate	37379733
Malformations of Cortical Development Group I	Stimulate	31159590, 8922409
Melanoma	Associate	19759550, 35046061
Memory Disorders	Associate	20862329, 21652708, 21841249, 23100439, 24848988, 28720165, 30120417, 33504764, 35738259, 38165363
Memory Disorders	Stimulate	27258307, 30563962, 39670385
Meningeal Neoplasms	Associate	25934480
Menopause Premature	Associate	34108509, 35471588
Mental Disorders	Associate	22702962, 30923322
Mental Disorders	Stimulate	24186361
Mesenteric Ischemia	Associate	24346217
Mevalonate Kinase Deficiency	Stimulate	10359654
Mevalonate Kinase Deficiency	Associate	10359654
Microaneurysm	Associate	36448495
Microphthalmia Syndromic 10	Associate	22976236, 31425744, 31437719, 31831374
Mitochondrial Diseases	Associate	16943564, 21678067, 22077634, 22174920, 24140124, 25961951, 26813924, 27329039, 30103547, 30683981, 34366346, 8577761
Mitochondrial Diseases	Stimulate	19496804, 23203093, 24905226, 24915567, 26010513, 26198711, 26542804, 27521081, 30310092, 30572643, 31159590, 32156251, 32367269, 36035216
Motor Neuron Disease	Associate	23127958
Mouth Neoplasms	Associate	28486965
Multiple Sclerosis	Associate	15148385
Muscle Neoplasms	Associate	9546349
Muscular Diseases	Associate	9326287
Muscular Disorders Atrophic	Associate	22702962
Muscular Dystrophy Duchenne	Stimulate	24843230
Myopathies Structural Congenital	Associate	30504224
Myositis	Associate	7774065
Myositis Inclusion Body	Associate	12787072, 14695312, 16049336, 16405511, 16441512, 17056255, 20616343, 25978849, 8577761, 9326287, 9546349
Myositis Inclusion Body	Stimulate	20236612
Myotonic Dystrophy	Associate	38165363
Nasopharyngeal Carcinoma	Stimulate	31180550
Necrosis	Stimulate	21272192, 22981873
Neointima	Associate	19141082, 8955370
Neoplasm Metastasis	Associate	32133800
Neoplasms	Associate	17540176, 20678196, 20943659, 22080244, 24733378, 26673618, 27507654, 28918420, 29122757, 31509551, 31833593, 32133800, 34685653, 34710239, 3500476, 39741285, 40178903, 7929051 View all (3 more)
Neoplasms	Inhibit	38148047
Nerve Degeneration	Stimulate	11927634, 23864927, 24048171, 24848988, 24905226, 31250578, 32058688, 32124921, 33318474, 34280181, 37024090, 39173065, 8610157
Nerve Degeneration	Associate	11939591, 12050157, 19822779, 20796026, 21159973, 21272192, 22461629, 22502767, 22867901, 23025824, 23634215, 24244308, 24859569, 25410733, 25743013 View all (12 more)
Nervous System Diseases	Stimulate	21398043
Nervous System Diseases	Associate	30153862
Neuraminidase 1 deficiency	Associate	21408230
Neuroblastoma	Associate	10861242, 12807963, 15251450, 15857408, 18194465, 19087254, 19350381, 19883607, 20490276, 20923778, 22108004, 22180352, 22867901, 23203093, 24473795, 26707976, 32224504, 34366346 View all (3 more)
Neuroblastoma	Stimulate	22580042
Neurocognitive Disorders	Associate	30152135, 32326569
Neurodegenerative Diseases	Associate	10487842, 16542157, 18378046, 19162185, 19483198, 19542221, 20943659, 21293490, 21652708, 22180352, 22267728, 22403062, 22477259, 22888099, 22976236 View all (41 more)
Neurodegenerative Diseases	Stimulate	20796026, 24326519, 28435263, 34591236, 36012298, 37620502, 40275379, 8922409
Neuroinflammatory Diseases	Associate	15882940, 19162185, 24346217, 32498476, 33220166, 35246267, 35697992, 37147668, 38138438
Neuroinflammatory Diseases	Stimulate	30403186, 31611872, 33352944, 35883623
Neurologic Manifestations	Associate	18234671, 19350381, 24359497, 27099354, 27979356, 29476081, 34469142, 35532913, 38454193
Neurotoxicity Syndromes	Stimulate	10389030, 11461976, 11927634, 15189856, 16151530, 18234110, 19383604, 20463975, 20796026, 21205220, 22242635, 22307680, 22385841, 22502767, 22670059 View all (22 more)
Neurotoxicity Syndromes	Associate	10934205, 12423364, 15034149, 15286082, 15459202, 17389590, 18234671, 18266928, 18508486, 19141082, 19286555, 19457079, 19759000, 21272192, 21447104 View all (41 more)
Niemann Pick Disease Type C	Stimulate	21205675
Niemann Pick Disease Type C	Associate	33672048
Night blindness congenital stationary	Associate	24326519, 30914681, 31208071, 36142742
Night blindness congenital stationary	Stimulate	26658733
Nijmegen Breakage Syndrome	Inhibit	14632755, 28000062
Non alcoholic Fatty Liver Disease	Associate	28796060
Obesity	Associate	18483477
Obesity	Inhibit	34689144, 39210402
Oculocutaneous albinism type 1	Associate	37569528
Olfaction Disorders	Stimulate	10619569
Osteoarthritis	Associate	37188537
Osteoporosis	Inhibit	33055205
Ovarian Neoplasms	Associate	36837407
Paralysis	Associate	27448508
Paraparesis Spastic	Associate	27614114, 35365805
Parkinson Disease	Associate	22170881, 23644819, 23825179, 25596881, 25604855, 25808939, 26497684, 26756745, 28395086, 28542444, 30826425, 31733655, 32753661, 33809978, 33832546
Parkinson Disease	Stimulate	29030452, 34983390
Parkinson Disease	Inhibit	34285331
Pelvic Organ Prolapse	Associate	30153862
Penile Induration	Inhibit	22952813
Periodontitis	Associate	33486152
Persistent Infection	Associate	33369208
Personality Disorders	Associate	30108157
Plaque Amyloid	Associate	10821838, 15522881, 15615705, 15890777, 16608822, 17170108, 19542221, 19725829, 20191120, 20464283, 21329555, 21640828, 21949245, 22572541, 23237523 View all (38 more)
Plaque Amyloid	Stimulate	21293490, 22261556, 22277654, 23812658, 25119265, 26827680
Plaque Atherosclerotic	Associate	17916554
Polycystic Ovary Syndrome	Stimulate	38256230
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	1421406
Primary Progressive Nonfluent Aphasia	Associate	20802215
Prion Diseases	Associate	19822779, 27016065, 29330303, 30961668, 36952379
Progressive supranuclear palsy atypical	Associate	17675576
Prostatic Neoplasms	Associate	25305487, 35962130
Protein Energy Malnutrition	Stimulate	19350381
Protein Losing Enteropathies	Associate	25934480
Psychotic Disorders	Associate	21093110
Pulmonary Disease Chronic Obstructive	Inhibit	32049827
Renal Insufficiency	Associate	10220456, 9893119
Renal Insufficiency Chronic	Associate	29036821
Respiratory System Abnormalities	Associate	37336366
Retinal Degeneration	Stimulate	24036938
Retinal Drusen	Associate	30849957, 33374505
Retrograde Degeneration	Stimulate	17344400, 24186361, 24326519, 34593014, 37620502
Retrograde Degeneration	Associate	18520330, 24848988, 36271678
Rupture	Associate	33918046
Sandhoff Disease	Associate	23127958
Sarcoidosis	Associate	28827283
Sciatic Neuropathy	Inhibit	35356751
Scleroderma Systemic	Stimulate	38570030
Seizures	Associate	21193246
Signs and Symptoms Digestive	Associate	33048222
Sjogren's Syndrome	Associate	25902739
Skin Diseases	Associate	29487944
Sleep Apnea Obstructive	Stimulate	39456840
Sleep Apnea Syndromes	Stimulate	24107601
Sleep Apnea Syndromes	Inhibit	24439479
Sleep Deprivation	Stimulate	29632177
Sleep Wake Disorders	Associate	32142100, 35491776
Spondylarthropathies	Associate	1424287
Squamous Cell Carcinoma of Head and Neck	Associate	17651731, 28486965
Stomach Diseases	Associate	30686901
Stomach Neoplasms	Associate	39702278
Stroke	Associate	12163376, 30338813, 39824235, 8579098
Sweating Sickness	Associate	24949887
Synucleinopathies	Associate	27979356
Systemic Inflammatory Response Syndrome	Associate	24346217
Tauopathies	Associate	18541914, 36773106
Tay Sachs Disease	Associate	14724290
TDP 43 Proteinopathies	Associate	32164763
Temporomandibular Joint Disorders	Associate	24275226
Teratocarcinoma	Associate	8415732
Tertiary Lymphoid Structures	Associate	15823129
Thinness	Stimulate	39210402
Thrombasthenia	Associate	15219201
Tongue Neoplasms	Associate	33174521
Tooth Loss	Associate	10487842, 21889115, 22637583
Trauma Nervous System	Stimulate	36674443
Tuberous Sclerosis	Associate	23586324
Vaginal Discharge	Associate	22702962
Vascular Diseases	Associate	35351867, 38353984
Vascular System Injuries	Associate	39752902
Ventricular Fibrillation	Associate	17170111, 33004626
Virus Diseases	Stimulate	21551363
Vitamin D Deficiency	Inhibit	34685653
Wallerian Degeneration	Associate	23354834
Weight Loss	Associate	40545561
Wounds and Injuries	Associate	24346217
Wounds and Injuries	Stimulate	25943889
ZAP70 deficiency	Associate	2136770

APP (amyloid beta precursor protein)