Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3501
Gene name Gene Name - the full gene name approved by the HGNC.	Immunoglobulin heavy constant gamma 2 (G2m marker)
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	IGHG2
Synonyms (NCBI Gene) Gene synonyms aliases	-
Chromosome Chromosome number	14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	14q32.33

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	20176268
GO:0002376	Process	Immune system process	IEA
GO:0003823	Function	Antigen binding	IBA
GO:0005515	Function	Protein binding	IPI	16457820
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	22664934, 23580065
GO:0005615	Component	Extracellular space	IDA	25645918
GO:0005615	Component	Extracellular space	NAS	20176268
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	20176268
GO:0006958	Process	Complement activation, classical pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019814	Component	Immunoglobulin complex	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IBA
GO:0042571	Component	Immunoglobulin complex, circulating	IBA
GO:0050853	Process	B cell receptor signaling pathway	NAS	20176268
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071735	Component	IgG immunoglobulin complex	NAS	20176268
GO:0072562	Component	Blood microparticle	HDA	22516433

MIM	HGNC	e!Ensembl
147110	5526	ENSG00000211893

Protein

UniProt ID

P01859

Protein name

Immunoglobulin heavy constant gamma 2 (Ig gamma-2 chain C region) (Ig gamma-2 chain C region DOT) (Ig gamma-2 chain C region TIL) (Ig gamma-2 chain C region ZIE)

Protein function

Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins s

PDB

2QSC , 4HAF , 4HAG , 4L4J , 7LUS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07654	C1-set	8 → 90	Immunoglobulin C1-set domain	Domain
PF07654	C1-set	119 → 207	Immunoglobulin C1-set domain	Domain
PF07654	C1-set	227 → 311	Immunoglobulin C1-set domain	Domain

Sequence

ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSNFGTQTYTCNVDHKPSNTKVDKTVERKCCVECPPCPAPPVAGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTFR
VVSVLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKN
QVSLTCLVKGFYPSDISVEWESNGQPENNYKTTPPMLDSDGSFFLYSKLTVDKSRWQQGN
VFSCSVMHEALHNHYTQKSLSLSPGK

Sequence length

326

Interactions

View interactions

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Hypothyroidism	Hypothyroidism	N/A	N/A	GWAS

Show/Hide Text Mining Associations (6)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Autoimmune Diseases	Associate	37843500
Infections	Associate	37434783
Neoplasms	Inhibit	36155774
Post Acute COVID 19 Syndrome	Associate	38518681
Sarcoma	Associate	36155774
Substance Related Disorders	Associate	37843500

IGHG2 (immunoglobulin heavy constant gamma 2 (G2m marker))