Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	349565
Gene name Gene Name - the full gene name approved by the HGNC.	Nicotinamide nucleotide adenylyltransferase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	NMNAT3
Synonyms (NCBI Gene) Gene synonyms aliases	FKSG76, PNAT-3, PNAT3
Chromosome Chromosome number	3
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	3q23
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the nicotinamide/nicotinic acid mononucleotide adenylyltransferase family. These enzymes use ATP to catalyze the synthesis of nicotinamide adenine dinucleotide or nicotinic acid adenine dinucleotide from nicotinamide mononucl

Show/Hide all(38)

miRTarBase ID	miRNA	Experiments
MIRT1187836	hsa-miR-4269	CLIP-seq
MIRT1187837	hsa-miR-4514	CLIP-seq
MIRT1187838	hsa-miR-4692	CLIP-seq
MIRT1187839	hsa-miR-4742-5p	CLIP-seq
MIRT1187840	hsa-miR-4777-3p	CLIP-seq
MIRT2054420	hsa-miR-188-5p	CLIP-seq
MIRT2054421	hsa-miR-1183	CLIP-seq
MIRT2054422	hsa-miR-1208	CLIP-seq
MIRT2054423	hsa-miR-34b	CLIP-seq
MIRT2283496	hsa-miR-1185	CLIP-seq
MIRT2283497	hsa-miR-1224-5p	CLIP-seq
MIRT2283498	hsa-miR-1277	CLIP-seq
MIRT2283499	hsa-miR-34c-3p	CLIP-seq
MIRT2283500	hsa-miR-3605-5p	CLIP-seq
MIRT2283501	hsa-miR-3679-5p	CLIP-seq
MIRT2283502	hsa-miR-3915	CLIP-seq
MIRT2283503	hsa-miR-3973	CLIP-seq
MIRT2283504	hsa-miR-4689	CLIP-seq
MIRT2283505	hsa-miR-548a-5p	CLIP-seq
MIRT2283506	hsa-miR-548ab	CLIP-seq
MIRT2283507	hsa-miR-548ak	CLIP-seq
MIRT2283508	hsa-miR-548b-5p	CLIP-seq
MIRT2283509	hsa-miR-548c-5p	CLIP-seq
MIRT2283510	hsa-miR-548d-5p	CLIP-seq
MIRT2283511	hsa-miR-548h	CLIP-seq
MIRT2283512	hsa-miR-548i	CLIP-seq
MIRT2283513	hsa-miR-548j	CLIP-seq
MIRT2283514	hsa-miR-548w	CLIP-seq
MIRT2283515	hsa-miR-548y	CLIP-seq
MIRT2283516	hsa-miR-559	CLIP-seq
MIRT2431614	hsa-miR-198	CLIP-seq
MIRT2431615	hsa-miR-338-3p	CLIP-seq
MIRT2431616	hsa-miR-3684	CLIP-seq
MIRT2431617	hsa-miR-411	CLIP-seq
MIRT2431618	hsa-miR-4530	CLIP-seq
MIRT2431619	hsa-miR-4660	CLIP-seq
MIRT2431620	hsa-miR-562	CLIP-seq
MIRT2431621	hsa-miR-646	CLIP-seq

Show/Hide all(12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000309	Function	Nicotinamide-nucleotide adenylyltransferase activity	IBA	21873635
GO:0004515	Function	Nicotinate-nucleotide adenylyltransferase activity	IBA	21873635
GO:0004515	Function	Nicotinate-nucleotide adenylyltransferase activity	IDA	16118205
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005739	Component	Mitochondrion	IBA	21873635
GO:0005739	Component	Mitochondrion	IDA	16118205
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0009165	Process	Nucleotide biosynthetic process	IC	16118205
GO:0009435	Process	NAD biosynthetic process	IBA	21873635
GO:0009435	Process	NAD biosynthetic process	IEA
GO:0019674	Process	NAD metabolic process	TAS

MIM	HGNC	e!Ensembl
608702	20989	ENSG00000163864

Protein

UniProt ID

Q96T66

Protein name

Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 (NMN/NaMN adenylyltransferase 3) (Nicotinamide-nucleotide adenylyltransferase 3) (NMN adenylyltransferase 3) (Nicotinate-nucleotide adenylyltransferase 3) (NaMN adenylyltransferase 3) (EC 2.

Protein function

Catalyzes the formation of NAD(+) from nicotinamide mononucleotide (NMN) and ATP (PubMed:16118205, PubMed:17402747, PubMed:26616331). Can also use the deamidated form; nicotinic acid mononucleotide (NaMN) as substrate with the same efficiency. C

PDB

1NUP , 1NUQ , 1NUR , 1NUS , 1NUT , 1NUU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01467	CTP_transf_like	10 → 208	Cytidylyltransferase-like	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in lung and spleen with lower levels in placenta and kidney. {ECO:0000269|PubMed:12574164, ECO:0000269|PubMed:16118205}.

Sequence

MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAA
SHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKAL
FSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESP
ILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWK
GKSTQSTEGKTS

Sequence length

252

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways Biosynthesis of cofactors		Nicotinate metabolism

NMNAT3 (nicotinamide nucleotide adenylyltransferase 3)