IGHA1 (immunoglobulin heavy constant alpha 1)

Gene

• Entrez ID: 3493
• Gene name: Immunoglobulin heavy constant alpha 1
• Gene symbol: IGHA1
• Synonyms (NCBI Gene): IgA1
• Chromosome: 14
• Chromosome location: 14q32.33

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002250	Process	Adaptive immune response	NAS	20176268
GO:0002376	Process	Immune system process	IEA
GO:0003094	Process	Glomerular filtration	IEA
GO:0003094	Process	Glomerular filtration	IMP	23398317
GO:0003823	Function	Antigen binding	IBA
GO:0003823	Function	Antigen binding	NAS	107164
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934, 23580065
GO:0005615	Component	Extracellular space	IDA	23398317
GO:0005615	Component	Extracellular space	NAS	20176268
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	NAS	20176268
GO:0006955	Process	Immune response	NAS	107164
GO:0006958	Process	Complement activation, classical pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0019731	Process	Antibacterial humoral response	IBA
GO:0019731	Process	Antibacterial humoral response	IDA	23250751
GO:0019731	Process	Antibacterial humoral response	IEA
GO:0019814	Component	Immunoglobulin complex	IEA
GO:0034987	Function	Immunoglobulin receptor binding	IDA	23250751
GO:0042571	Component	Immunoglobulin complex, circulating	IBA
GO:0050853	Process	B cell receptor signaling pathway	NAS	20176268
GO:0060267	Process	Positive regulation of respiratory burst	IDA	24145934
GO:0060267	Process	Positive regulation of respiratory burst	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337, 23533145
GO:0071735	Component	IgG immunoglobulin complex	NAS	20176268
GO:0071745	Component	IgA immunoglobulin complex	NAS	20176268
GO:0071748	Component	Monomeric IgA immunoglobulin complex	IDA	23250751
GO:0071748	Component	Monomeric IgA immunoglobulin complex	IEA
GO:0071751	Component	Secretory IgA immunoglobulin complex	IDA	23250751, 24145934, 32029686
GO:0071752	Component	Secretory dimeric IgA immunoglobulin complex	IDA	24145934
GO:0071752	Component	Secretory dimeric IgA immunoglobulin complex	IEA
GO:0072562	Component	Blood microparticle	HDA	22516433

Other IDs

• MIM: 146900
• HGNC: 5478
• e!Ensembl: ENSG00000211895

Protein

• UniProt ID: P01876
• Protein name: Immunoglobulin heavy constant alpha 1 (Ig alpha-1 chain C region) (Ig alpha-1 chain C region BUR) (Ig alpha-1 chain C region TRO)
• Protein function: Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins s
• PDB: 1IGA, 1OW0, 2ESG, 2QEJ, 3CHN, 6LX3, 6LXW, 6UE7, 6XJA, 7UVL, 8SKU, 8SKV
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07654	C1-set	8 → 92	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	230 → 320	Immunoglobulin C1-set domain	Domain

• Sequence:

  ASPTSPKVFPLSLCSTQPDGNVVIACLVQGFFPQEPLSVTWSESGQGVTARNFPPSQDAS
  GDLYTTSSQLTLPATQCLAGKSVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSP
  SCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGVTFTWTPSSGKSAVQGPPERDLC
  GCYSVSSVLPGCAEPWNHGKTFTCTAAYPESKTPLTATLSKSGNTFRPEVHLLPPPSEEL
  ALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRV
  AAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY

• Sequence length: 353