Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
349075
Gene name Gene Name - the full gene name approved by the HGNC.
Zinc finger protein 713
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ZNF713
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p11.2
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene contains C2H2 zinc finger domains. In some individuals, a CGG-repeat expansion from 5-22 repeats to 68-450 repeats has been identified in the first intron of this gene. This mutation is thought to effect the expression of
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT617968 hsa-miR-561-3p HITS-CLIP 23824327
MIRT617967 hsa-miR-3144-3p HITS-CLIP 23824327
MIRT617966 hsa-miR-4668-5p HITS-CLIP 23824327
MIRT617968 hsa-miR-561-3p HITS-CLIP 23824327
MIRT617967 hsa-miR-3144-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0006355 Process Regulation of DNA-templated transcription IBA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616181 22043 ENSG00000178665
Protein
UniProt ID Q8N859
Protein name Zinc finger protein 713
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01352 KRAB 18 59 KRAB box Family
PF00096 zf-C2H2 273 295 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 301 323 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 329 351 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 357 379 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 385 407 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal and adult brain. {ECO:0000269|PubMed:25196122}.
Sequence
MEEEEMNDGSQMVRSQESLTFQDVAVDFTREEWDQLYPAQKNLYRDVMLENYRNLVALGY
QLCKPEVIAQLELEEEWVIERDSLLDTHPDGENRPEIKKSTTSQNISDENQTHEMIMERL
AGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHKKITQERSLECNKFAENCNLNS
NLMQQRIPSIKIPLNSDTQGNSIKHNSDLIYYQGNYVRETPYEYSECGKIFNQHILLTDH
IHTAEKPSECGKAFSHTSSLSQPQMLLTGEKPYKCDECGKRFSQRIHLIQHQRIHTGEKP
FICNGCGKAFRQHSSFTQHLRIHTGEKPYKCNQCGKAFSRITSLTEHHRLHTGEKPYECG
FCGKAFSQRTHLNQHERTH
TGEKPYKCNECGKAFSQSAHLNQHRKIHTREKLCEYKCEQT
VRHSPSFSST
Sequence length 430
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Autism autism N/A N/A GenCC
Diabetes Type 2 diabetes N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Crohn Disease Associate 32581322