Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
348980
Gene name Gene Name - the full gene name approved by the HGNC.
Hyperpolarization activated cyclic nucleotide gated potassium channel 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HCN1
Synonyms (NCBI Gene) Gene synonyms aliases
BCNG-1, BCNG1, DEE24, EIEE24, GEFSP10, HAC-2
Chromosome Chromosome number
5
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
5p12
Summary Summary of gene provided in NCBI Entrez Gene.
The membrane protein encoded by this gene is a hyperpolarization-activated cation channel that contributes to the native pacemaker currents in heart and neurons. The encoded protein can homodimerize or heterodimerize with other pore-forming subunits to fo
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs373454105 C>T Conflicting-interpretations-of-pathogenicity Missense variant, coding sequence variant
rs373664268 G>T Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant
rs376434225 A>G Likely-benign, conflicting-interpretations-of-pathogenicity Intron variant
rs587777491 C>G Pathogenic Coding sequence variant, missense variant
rs587777492 G>A Pathogenic Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT442782 hsa-miR-4662a-5p PAR-CLIP 22100165
MIRT442782 hsa-miR-4662a-5p PAR-CLIP 22100165
MIRT1042079 hsa-miR-105 CLIP-seq
MIRT1042080 hsa-miR-1178 CLIP-seq
MIRT1042081 hsa-miR-135a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0003254 Process Regulation of membrane depolarization IBA
GO:0003254 Process Regulation of membrane depolarization IDA 16043489
GO:0003254 Process Regulation of membrane depolarization IEA
GO:0005216 Function Monoatomic ion channel activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602780 4845 ENSG00000164588
Protein
UniProt ID O60741
Protein name Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 (Brain cyclic nucleotide-gated channel 1) (BCNG-1)
Protein function Hyperpolarization-activated ion channel that are permeable to sodium and potassium ions (PubMed:15351778, PubMed:28086084). Displays lower selectivity for K(+) over Na(+) ions (PubMed:28086084). Contributes to the native pacemaker currents in he
PDB 5U6O , 5U6P , 6UQF , 6UQG , 8T4M , 8T4Y , 8T50 , 8UC7 , 8UC8 , 9BC6 , 9BC7
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08412 Ion_trans_N 98 141 Ion transport protein N-terminal Family
PF00520 Ion_trans 142 405 Ion transport protein Family
PF00027 cNMP_binding 493 576 Cyclic nucleotide-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in brain, in particular in amygdala and hippocampus, while expression in caudate nucleus, corpus callosum, substantia nigra, subthalamic nucleus and thalamus is very low or not detectable. Detected at very low levels in muscle
Sequence
MEGGGKPNSSSNSRDDGNSVFPAKASATGAGPAAAEKRLGTPPGGGGAGAKEHGNSVCFK
VDGGGGGGGGGGGGEEPAGGFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAV
EKEQERVKTAGFWIIHPYSDF
RFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNV
ASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVE
KGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFN
LIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIG
YGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRR
QYQEKYKQVEQYMSF
HKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANAD
PNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGE
ICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEY
PMMRRAFETVAIDRLDRIGKKNSI
LLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIAPINYPQMTTLNSTSSTTTPTSRM
RTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYTTAVCSPPVQSPLAARTFHYA
SPTASQLSLMQQQPQQQVQQSQPPQTQPQQPSPQPQTPGSSTPKNEVHKSTQALHNTNLT
REVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPQPVTAVPGTGLQAGGRSTVPQRVT
LFRQMSSGAIPPNRGVPPAPPPPAAALPRESSSVLNTDPDAEKPRFASNL
Sequence length 890
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  GnRH secretion   HCN channels
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Developmental And Epileptic Encephalopathy Developmental and epileptic encephalopathy, 24 rs587777493, rs587777494, rs587777495, rs1561139569, rs1057519547, rs1057519548, rs587777492, rs1057521989, rs1554040120 N/A
Epileptic Encephalopathy early infantile epileptic encephalopathy with suppression bursts rs1561139569, rs587777495, rs763339068, rs587777492, rs1554037381 N/A
Epileptic encephalopathy epileptic encephalopathy rs1057519547, rs1057519548 N/A
Generalized Epilepsy with Febrile Seizures Plus Generalized epilepsy with febrile seizures plus, type 10 rs1561230486, rs1561139569, rs1561081319, rs1318391259, rs1561120793, rs1561230606, rs587777492 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Alzheimer disease Alzheimer's disease or family history of Alzheimer's disease N/A N/A GWAS
Breast Cancer Cancer code, self-reported: breast cancer (UKB data field 20001_1002), Postmenopausal breast cancer N/A N/A GWAS
Breast cancer Breast cancer, Invasive breast cancer N/A N/A GWAS
Diabetes Type 2 diabetes, Type 2 diabetes (PheCode 250.2), Type 2 diabetes or schizophrenia (pleiotropy) N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 19232126, 20605201, 22045194, 27863437, 28178648
Colorectal Neoplasms Associate 35202405
Disease Associate 37239316
Encephalitis Associate 7700510
Epilepsies Myoclonic Associate 30776697
Hemimegalencephaly Associate 7700510
Pain Associate 35806193
Peripheral Nervous System Diseases Associate 35806193
Prostatic Neoplasms Associate 37239316
Schizophrenia Associate 31596458